Sceloporus undulatus (fence lizard): 121916658 Help Entry 121916658         CDS       T07740                                  Symbol RAN Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism sund  Sceloporus undulatus (fence lizard) Pathway sund03008   Ribosome biogenesis in eukaryotes sund03013   Nucleocytoplasmic transport sund03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:sund00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     121916658 (RAN)    03008 Ribosome biogenesis in eukaryotes     121916658 (RAN)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     121916658 (RAN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sund03019]     121916658 (RAN)    03009 Ribosome biogenesis [BR:sund03009]     121916658 (RAN)    03016 Transfer RNA biogenesis [BR:sund03016]     121916658 (RAN)    03036 Chromosome and associated proteins [BR:sund03036]     121916658 (RAN)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sund04147]     121916658 (RAN)    04031 GTP-binding proteins [BR:sund04031]     121916658 (RAN) Messenger RNA biogenesis [BR:sund03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      121916658 (RAN) Ribosome biogenesis [BR:sund03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     121916658 (RAN)   Pre-60S particles     121916658 (RAN) Transfer RNA biogenesis [BR:sund03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     121916658 (RAN) Chromosome and associated proteins [BR:sund03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      121916658 (RAN)    Spindle formation proteins     121916658 (RAN) Exosome [BR:sund04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121916658 (RAN) GTP-binding proteins [BR:sund04031]  Small (monomeric) G-proteins   Ran Family    Ran     121916658 (RAN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RNA_helicase G-alpha Pox_A32 AAA_24 ArgoMid Septin AAA_7 SRPRB TsaE AAA_16 DUF5906 AAA_22 Motif Other DBs NCBI-GeneID:  121916658 NCBI-ProteinID:  XP_042297918 LinkDB All DBs Position 10:6908324..6915414 Genome browser AA seq 217 aa AA seqDB search MAAPQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPI KFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVL CGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM PALAPPEVVMDPALAAQYEQDLQIAQTTALPDEDDDL NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atggccgccccgcaaggagaaccccaagtgcagtttaagcttgttttggttggtgatggt ggtaccggtaaaacaacatttgttaagcgccacttgactggtgaatttgagaagaaatat gtagctactctgggtgttgaagtccatcctctggtgttccacactaacagaggtccaatt aaatttaatgtatgggacacagctgggcaagaaaagtttggaggtctgagagatggctat tacattcaagctcagtgtgccatcataatgtttgatgtaacatccagagttacgtacaag aacgtacccaactggcatagagatctggtccgggtgtgtgagaacatccccatagttttg tgtggcaacaaagtggatatcaaggacaggaaagtcaaggcaaaatcgattgtttttcac cggaagaagaatctgcagtattatgatatttcagccaagagtaactacaactttgagaag ccttttctgtggctggcaagaaagctaatcggcgatcccaacttggaatttgttgccatg cctgctcttgcaccaccagaagttgttatggatccagcactggcagcacaatatgagcaa gatttacagattgctcagaccactgcactgcctgatgaagatgatgacctgtga

DBGET integrated database retrieval system