Sceloporus undulatus (fence lizard): 121932202 Help Entry 121932202         CDS       T07740                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sund  Sceloporus undulatus (fence lizard) Pathway sund03420   Nucleotide excision repair sund04110   Cell cycle sund04114   Oocyte meiosis sund04120   Ubiquitin mediated proteolysis sund04141   Protein processing in endoplasmic reticulum sund04310   Wnt signaling pathway sund04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:sund00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121932202 (RBX1)    04120 Ubiquitin mediated proteolysis     121932202 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     121932202 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     121932202 (RBX1)    04350 TGF-beta signaling pathway     121932202 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     121932202 (RBX1)    04114 Oocyte meiosis     121932202 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sund04121]     121932202 (RBX1)    03400 DNA repair and recombination proteins [BR:sund03400]     121932202 (RBX1) Enzymes [BR:sund01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      121932202 (RBX1) Ubiquitin system [BR:sund04121]  Ubiquitin ligases (E3)   UBL E3 ligases    121932202 (RBX1)   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      121932202 (RBX1)    Cul2 complex      121932202 (RBX1)    Cul3 complex      121932202 (RBX1)    Cul4 complex      121932202 (RBX1)    Cul7 complex      121932202 (RBX1)    Cul8 complex      121932202 (RBX1)    Cul9 complex      121932202 (RBX1) DNA repair and recombination proteins [BR:sund03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       121932202 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       121932202 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  121932202 NCBI-ProteinID:  XP_042326613 LinkDB All DBs Position 5:38014232..38018719 Genome browser AA seq 122 aa AA seqDB search MRIEGKPAGSWLFKMAAAMDVDTPSGTNSSAGKKRFEVKKWNAVALWAWDIVVDNCAICR NHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY GH NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgcgcattgaaggaaagcctgccgggagttggttattcaaaatggctgccgcgatggat gtagacacaccgagtggcaccaacagcagcgccggcaagaagcgtttcgaagtgaagaag tggaacgctgttgcactctgggcttgggacattgtggttgacaactgtgccatttgcaga aaccacattatggatttgtgcatagaatgtcaagctaaccaagcatcagctacctctgaa gaatgcactgttgcatggggtgtctgtaatcatgctttccattttcattgcatctctcgc tggcttaagactcggcaggtgtgccccttagacaaccgagaatgggaattccagaagtat ggacactag

DBGET integrated database retrieval system