Superficieibacter sp. HKU1: P0H77_04375 Help Entry P0H77_04375       CDS       T08896                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism supe  Superficieibacter sp. HKU1 Pathway supe00670   One carbon pool by folate supe00790   Folate biosynthesis supe01100   Metabolic pathways supe01240   Biosynthesis of cofactors supe04981   Folate transport and metabolism Module supe_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:supe00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     P0H77_04375 (folA)    00670 One carbon pool by folate     P0H77_04375 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     P0H77_04375 (folA) Enzymes [BR:supe01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      P0H77_04375 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 DUF7466 Motif Other DBs NCBI-ProteinID:  WES69251 LinkDB All DBs Position 895063..895542 Genome browser AA seq 159 aa AA seqDB search MISLIAALAVDRVIGMENAMPWDLPADLAWFKRTTLNKPVVMGRLTWESIGRPLPGRKNI VISSQPGSDDRVQWVKSVDEAIAACGDAEEIMVIGGGRVYEQFLPKASKLYLTHIDAEVE GDTHFPDYEPDEWESVFSEFHDADAQNSHSYCFEILERR NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatcagtctgattgcggcgttagcggtagatcgcgtcatcggtatggaaaacgccatg ccctgggatctacccgcagatctcgcctggtttaaacgtactactctgaacaagccggtt gttatgggtcgcctgacctgggaatccatcggccgtccgctgccggggcgtaaaaatatc gtgatcagcagccagccaggctctgacgatcgcgtccagtgggtgaagtcggtggatgaa gcgattgccgcctgcggcgatgccgaagagattatggtgattggcggcgggcgcgtatac gaacagttcctgcccaaagccagcaagctctacctgacgcatattgatgctgaggtagaa ggggacacgcacttcccggactacgagccggatgaatgggaatcggtgttcagcgaattt cacgatgcggacgcgcagaactcgcacagctattgttttgagattctggaacggcgttaa

DBGET integrated database retrieval system