KEGG   Serratia ureilytica: J0X03_06230
Entry
J0X03_06230       CDS       T07185                                 
Symbol
ligA
Name
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03410  Base excision repair
suri03420  Nucleotide excision repair
suri03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_06230 (ligA)
   03410 Base excision repair
    J0X03_06230 (ligA)
   03420 Nucleotide excision repair
    J0X03_06230 (ligA)
   03430 Mismatch repair
    J0X03_06230 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_06230 (ligA)
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_06230 (ligA)
Enzymes [BR:suri01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     J0X03_06230 (ligA)
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     J0X03_06230 (ligA)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     J0X03_06230 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     J0X03_06230 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     J0X03_06230 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      J0X03_06230 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT DNA_ligase_ZBD PTCB-BRCT 5_3_exonuc HHH zf-NADH-PPase
Other DBs
NCBI-ProteinID: QSR08578
LinkDB
Position
1349980..1352001
AA seq 673 aa
MESIIQQINQLRATLRHHEYQYHVLDAPEVPDAEYDRLMRELRELESAHPELITADSPTQ
RVGAAPLAAFDQVRHEVPMLSLDNVFDEESFLAFYKRVQDRLKSSDPLTFCCELKLDGLA
VSLLYEDGELVRAATRGDGTTGENITSNVRTIRAIPLRLTGDNIPRRLEVRGEVFMPQAG
FEQMNEEARRKDGKVFANPRNAAAGSLRQLDPRITAKRPLTFFCYGVGLLEGGELPRSHF
ERLMQFKAWGLPVSDRAQRRTGSEEVLAFYRQVERDRAQLGFDIDGVVIKIDDIDLQETL
GFVARAPRWATAFKFPAQEQITVVREVEFQVGRTGAITPVARLEPVLVAGVTVSNATLHN
ADEIERLGLRIGDTVIVRRAGDVIPQVVGVLEDRRPQDAREVVFPLHCPVCGSDVERVEG
EAVARCTGGLICGAQRKEALKHFVSRRALDVEGMGDKIIEQLVDKEYVKNPADLFRLSAG
ILTGLDRMGPKSAQNLVNALEKSKQTTFARFLYALGIREVGEATAANLAAHFGSLEKLFS
ADIEALKEVPDVGEVVAKHTRNFLDEALNQQVINELVGAEIGIHWPAPVMVVAEEIDSPF
AGKTVVLTGSLSQLSRDEAKDRLTALGAKVSGSVSKKTDLVIAGEAAGSKLAKAQELGIA
VIDEAEMIRLLGD
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggaatcgataatccaacaaatcaatcaactacgagccacattgcgccatcatgaatac
cagtatcatgtgctggatgcgcccgaagtgccggatgcggaatatgaccgcctgatgcgc
gagctgcgcgagctcgagagcgcgcatccggagctgatcaccgccgattcgccgacccag
cgcgtgggcgcggcgccgctggcggcgtttgatcaggtgcgtcacgaagtgccgatgctg
tcgctggacaacgtgttcgacgaagagagcttcctggcgttttacaagcgcgtgcaggac
aggctcaagagcagcgatccgctgaccttctgctgcgagctgaagctggacggcctggcg
gtcagcctgctgtacgaagacggcgagctggtgcgtgcggcgacgcgcggcgacggcacc
accggcgagaacatcacctccaacgtgcgcaccattcgcgccatcccgctgcgcctgacc
ggcgacaacatcccgcgccggctggaagtgcgcggcgaagtgttcatgccgcaggccggg
tttgaacagatgaacgaagaggcgcggcgcaaagacggtaaggtgttcgccaatccgcgc
aacgccgccgccggttcgctgcgccagctcgatccgcgcattaccgccaaacgcccgctg
accttcttctgctatggcgtcgggctgctggaaggcggcgagctgccgcgcagccacttt
gaacgcctgatgcagttcaaggcctggggcctgccggtcagcgatcgcgcccagcgccgc
accggcagcgaggaagtgctggcgttctatcgccaggtcgagcgggaccgcgcacagctc
ggtttcgatattgacggcgtggtgatcaagattgacgacatcgatctgcaggaaacgctg
ggcttcgtggcgcgtgcgccgcgctgggcgacggcgttcaaattcccggcgcaggagcag
atcaccgtggtgcgcgaagtggagtttcaggttggccgcaccggcgcgattacgccggtg
gcgcgccttgaaccggtgctggtggccggggtgaccgtcagtaacgccaccttgcacaac
gccgatgaaattgagcgtctggggctgcgcatcggcgatacggtgatcgtgcgccgcgcc
ggcgacgtgatcccgcaggtggtgggggtgctggaagaccgcaggccgcaggatgcgcgc
gaagtggtgttcccgctgcactgcccggtgtgcggctccgacgttgagcgcgtggaaggc
gaagccgttgcgcgctgcaccggcgggctgatctgcggggcgcagcgcaaagaggcgttg
aagcatttcgtttctcgccgcgcgctggacgtcgaaggcatgggcgacaagatcatcgag
caactggtggacaaggagtacgtgaagaacccggccgatctgttccgcctgtccgccggc
attctgaccggtctggatcgcatggggccgaaatcggcacagaacctggttaacgcgctg
gagaaatccaagcagaccaccttcgcccgtttcctgtatgcgctcggcattcgcgaggtt
ggtgaagcgaccgccgccaacctggcggcgcatttcggatcgctcgagaagttgttttcc
gccgatatcgaagcgctgaaagaggtgccggacgttggcgaagtggtggccaaacacact
cgcaacttcctcgatgaagcgctcaatcagcaggtgatcaacgagctggtgggcgccgag
attggcatccattggccggcgccggtgatggtggtggcggaggagatagacagcccgttc
gccggtaaaaccgtggtgctgaccggctcgctgagccagctgtcgcgcgacgaggccaaa
gatcgcctgacggcgttgggcgccaaggtcagcggcagcgtgtcgaagaaaaccgatctg
gtgatcgccggcgaagcggccggttccaagctggcgaaggcgcaggagctgggtatcgcc
gtgatcgacgaagcggagatgatccgcttgctgggtgactga

DBGET integrated database retrieval system