KEGG   Streptomyces viridifaciens: CP971_23955
Entry
CP971_23955       CDS       T06960                                 

Name
(GenBank) methyltransferase
  KO
K14255  4-amino-anhydrotetracycline N4-methyltransferase [EC:2.1.1.335]
Organism
svr  Streptomyces viridifaciens
Pathway
svr00253  Tetracycline biosynthesis
svr01057  Biosynthesis of type II polyketide products
svr01100  Metabolic pathways
svr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:svr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CP971_23955
   00253 Tetracycline biosynthesis
    CP971_23955
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:svr01008]
    CP971_23955
Enzymes [BR:svr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.335  4-amino-anhydrotetracycline N4-methyltransferase
     CP971_23955
Polyketide biosynthesis proteins [BR:svr01008]
 Polyketide tailoring proteins
  Methylase
   CP971_23955
SSDB
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_12 Methyltransf_25 Methyltransf_23 Methyltransf_11 HTH_10 Dimerisation
Other DBs
NCBI-ProteinID: QEV01884
UniProt: A0A1L9DR24
LinkDB
Position
complement(5411499..5412533)
AA seq 344 aa
MTSSTDSAAARARRIVALNTAYFQAKALQSAVELGLFELLAERSAGLDQIRAELGVRHRL
FKDFLNALVGLGLLDEQDGGYRASELAREFLLPGPTYLGGTARQHARLHYHAWAQLTDAL
RDGKAKSAVAAQGQLAYPKQYEDLDRARQIMLHMDAHNGFTADELARAIDWSRYTSFVDV
GGGRGNVASRIVTAHPHLRGGVFDLPALRPLFEELVASAGTADRVDFHGGDFFATDLPEA
DVVIFGHVLPDWPVGDRRELLRRAHKAVRPGGLVVLYDAMIDPEERDPEVLLQRINHTMI
RDEAGAYSLQEARAYLEEAGFTVDRIAASDTITRDHFAIGVKSV
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgacctcgtccaccgacagcgccgccgcccgcgcgcgccggatcgtcgccctcaacacc
gcctacttccaggcgaaggcgctgcagagcgcggtcgagctcggcctcttcgagctgctc
gccgagcgctccgccgggctcgaccagatccgcgccgaactgggcgtccggcaccggctg
ttcaaggacttcctgaacgccctggtcggcctcggcctgctggacgagcaggacggcggc
taccgggcctccgagctcgcccgggagttcctgctccccggccccacgtacctcggcggc
accgcccgccagcacgctcggctgcactaccacgcctgggcgcagctgaccgacgcgctg
cgcgacggcaaggccaagtcggccgtggccgcgcagggccagctggcctaccccaagcag
tacgaggacctggaccgcgcccggcagatcatgctgcacatggacgcccacaacggtttc
acggccgacgagttggcgcgcgcgatcgactggagccggtacacctccttcgtggacgtc
ggcggcgggcgcggcaacgtcgcctcccggatcgtcaccgcccacccgcacctgcgcggc
ggggtcttcgacctgccggcgctgcgcccgctcttcgaggagctggtggcctcggccgga
accgccgaccgggtggacttccacggcggtgacttcttcgccaccgacctgccggaggcg
gacgtggtgatcttcggtcacgtcctgccggactggccggtcggggaccgcagggagctg
ctgcgccgcgcccacaaggcggtgcgcccgggcggcctggtggtgctgtacgacgccatg
atcgacccggaggagcgcgacccggaggtcctgctgcagcggatcaaccacaccatgatc
cgggacgaggccggggcgtactcgctgcaggaggcccgcgcctacctggaggaggccggc
ttcaccgtcgaccggatcgccgcctccgacaccatcacccgcgaccacttcgccatcggc
gtcaagtcggtctga

DBGET integrated database retrieval system