Setaria viridis (green foxtail): 117835140 Help Entry 117835140         CDS       T07951                                  Name (RefSeq) uncharacterized protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism svs  Setaria viridis (green foxtail) Pathway svs03420   Nucleotide excision repair svs04120   Ubiquitin mediated proteolysis svs04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:svs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117835140    04120 Ubiquitin mediated proteolysis     117835140   09124 Replication and repair    03420 Nucleotide excision repair     117835140  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:svs04121]     117835140    03400 DNA repair and recombination proteins [BR:svs03400]     117835140 Enzymes [BR:svs01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      117835140 Ubiquitin system [BR:svs04121]  Ubiquitin ligases (E3)   UBL E3 ligases    117835140   Multi subunit type E3    SCF complex     Ring finger protein      117835140    Cul2 complex      117835140    Cul3 complex      117835140    Cul4 complex      117835140    Cul7 complex      117835140    Cul8 complex      117835140    Cul9 complex      117835140 DNA repair and recombination proteins [BR:svs03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       117835140     TCR (transcription coupled repair) factors      Cul4-CSA complex       117835140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  117835140 NCBI-ProteinID:  XP_034570407 LinkDB All DBs Position 1:35478418..35480594 Genome browser AA seq 112 aa AA seqDB search MDKGGVAVAPTPAGSSAAAGKKAKRFDIKKWNAVSLWAWDIVVDNCAICRNHIMDLCIEC QANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggacaagggcggcgtcgcggttgccccgaccccggcgggctcctccgctgccgcgggg aagaaggccaaacgcttcgacatcaagaagtggaacgccgtctccctctgggcctgggac atcgtggtggacaactgcgccatctgccgcaaccacatcatggacctctgcatcgagtgc caggcgaaccaggcgagcgccacaagcgaggagtgcaccgtcgcttggggagtttgcaac catgcattccacttccactgcatcagtcgttggctcaagacccgtcaagtgtgccctcta gacaacagcgagtgggagttccagaagtatggtcactag

DBGET integrated database retrieval system