Sphingomonas xanthus: FMM02_02975 Help Entry FMM02_02975       CDS       T07168                                  Name (GenBank) hypothetical protein   KO K01658   anthranilate synthase component II [EC:4.1.3.27] Organism sxa  Sphingomonas xanthus Pathway sxa00400   Phenylalanine, tyrosine and tryptophan biosynthesis sxa01100   Metabolic pathways sxa01110   Biosynthesis of secondary metabolites sxa01230   Biosynthesis of amino acids sxa02024   Quorum sensing Brite KEGG Orthology (KO) [BR:sxa00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     FMM02_02975   09110 Biosynthesis of other secondary metabolites    00405 Phenazine biosynthesis     FMM02_02975  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     FMM02_02975 Enzymes [BR:sxa01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.3  Oxo-acid-lyases     4.1.3.27  anthranilate synthase      FMM02_02975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GATase Motif Other DBs NCBI-ProteinID:  QDP19011 UniProt:  A0A516IQ25 LinkDB All DBs Position complement(594486..594809) Genome browser AA seq 107 aa AA seqDB search MRAYSFSTPGSSGVILLVDNRDSFTFNLAGAFRSAGAEVVVVRNSIAAGEALYRATRLGA SIMLSPGPGAPCDAGCCIELVRQAKGLVPVIGSCLGPRRSSPRRAGR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgcgggcctattctttttccacgcctgggagcagtggcgtgatcctcctcgtcgacaat cgcgacagcttcactttcaacttggctggcgccttccgctcggcgggcgcggaggtggtc gtggtacgcaacagcatcgccgctggcgaggcgctctatcgcgcaaccaggcttggcgcc tccataatgctgtcgcctggtcccggcgccccgtgcgatgccggatgctgcatcgagctt gtgaggcaggccaagggcctagttccggtcatcggaagttgccttgggcccagacgatca tcgccgaggcgggcgggcaggtag

DBGET integrated database retrieval system