Staphylococcus xylosus C2a: SXYL_01417 Help Entry SXYL_01417        CDS       T03742                                  Symbol folA Name (GenBank) Dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism sxo  Staphylococcus xylosus C2a Pathway sxo00670   One carbon pool by folate sxo00790   Folate biosynthesis sxo01100   Metabolic pathways sxo01240   Biosynthesis of cofactors sxo04981   Folate transport and metabolism Module sxo_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sxo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SXYL_01417 (folA)    00670 One carbon pool by folate     SXYL_01417 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     SXYL_01417 (folA) Enzymes [BR:sxo01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      SXYL_01417 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  CEF18801 UniProt:  C6ZDI7 LinkDB All DBs Position Chr1:1462859..1463344 Genome browser AA seq 161 aa AA seqDB search MTLSILVAHDQQRVIGVNNQLPWHLPSDLKHVKALTTGNTLVMGRATFDSIGKPLPNRRN VVLTRNKSFHHEGVDVIHSMDDIYNLPGHVFIFGGQSLFEEMIDKVDDMYITVIEDKYNG DTFFPPYTFKDWEVESSVKGKIDEKNTIPHTFLHLTRKETS NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgacactatcaatactagtagctcatgaccaacagcgtgtcatcggggtaaataatcaa ttaccttggcacttacctagtgatttaaaacatgtaaaagctttaaccacgggcaatacg cttgtcatgggccgtgcaacattcgattctattgggaagccgcttcctaatagacgtaat gttgttttaacaaggaataaatcattccatcacgaaggtgtagatgttatacattcaatg gatgatatttataacttaccagggcatgtattcatttttggtggtcaatctctttttgaa gaaatgattgataaagttgatgatatgtatatcactgtgatagaggataaatataatggc gatacatttttcccgccatatacttttaaagattgggaagttgaatcatcagttaagggg aaaattgatgaaaagaacacaattcctcacacttttttacatttgacgcgtaaggaaact tcatag

DBGET integrated database retrieval system