KEGG   Synechococcus sp. RCC307: SynRCC307_2409
Entry
SynRCC307_2409    CDS       T00523                                 
Symbol
ligA
Name
(GenBank) NAD-dependent DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
syr  Synechococcus sp. RCC307
Pathway
syr03030  DNA replication
syr03410  Base excision repair
syr03420  Nucleotide excision repair
syr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:syr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SynRCC307_2409 (ligA)
   03410 Base excision repair
    SynRCC307_2409 (ligA)
   03420 Nucleotide excision repair
    SynRCC307_2409 (ligA)
   03430 Mismatch repair
    SynRCC307_2409 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:syr03032]
    SynRCC307_2409 (ligA)
   03400 DNA repair and recombination proteins [BR:syr03400]
    SynRCC307_2409 (ligA)
Enzymes [BR:syr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     SynRCC307_2409 (ligA)
DNA replication proteins [BR:syr03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     SynRCC307_2409 (ligA)
DNA repair and recombination proteins [BR:syr03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     SynRCC307_2409 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SynRCC307_2409 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     SynRCC307_2409 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SynRCC307_2409 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 DNA_ligase_ZBD PTCB-BRCT Nlig-Ia BRCT_2 zf-tcix Auto_anti-p27 RNA_ligase Zn_ribbon_RPB9
Other DBs
NCBI-ProteinID: CAK29312
UniProt: A5GWQ3
LinkDB
Position
2102907..2104934
AA seq 675 aa
MAFTAQQQLRAAELRQLLNRAAHAYYVLDAPEFEDAVYDRLYRELLDLEQQHPDLLSADS
PTQRVGGPPAEGFSSVEHRIGMLSLDNAFNAEELQAWDARLGRQLEDNPERQREYVCELK
IDGNALALSYADGVLVRAATRGDGSRGEEITANVRTIQAVPLRLQLKQPPAWVEVRGEAF
IPDDTFEAINAERQQRGEALFANPRNACAGTLRQLDPKAVAARRLDFFAYTVHLPADEMG
PKSQWDALQWLETAGFRVNPHRERTSGADGVVAFYDRWEEQRHQLPYATDGVVVKLDALE
RQQLAGFTQKAPRWAIALKYAAEEAPSRLLRLVAQVGRTGVVTPVAEFEAVPLAGTSVSR
ATLHNADRLEELDLHSGDTIVVRKAGEIIPEVLRVLPELRPEGAEQLELPSHCPECGSLL
VRESGEAATRCVNSSCPAILRGALRHWVSRQAMDVDGLGGKLIEQLVDRGLVRSIADLYR
LDAALLASLERMGEQSASNLIEALAASRQRPWHRLLYALGIHHIGSVNAKTLAAAFPSWE
ALQSASEEALNELYGIGPEISQSMQQWCSTEANQSLMAELAALELPLASDDSSAESAGAI
GALTGQTLVLTGTLPNLSRLEAQALIEAAGGKVTGSVSKKTNYVVAGSEAGSKLQKAEKL
GVAVIDEAELKALLS
NT seq 2028 nt   +upstreamnt  +downstreamnt
atggcgttcaccgcccagcagcagctgcgggctgccgaactgcggcagctcctgaaccgg
gcagcccacgcctattacgtgctggatgcccctgaatttgaagacgccgtctacgaccgg
ctctaccgggagttgttggaccttgagcagcaacaccccgacctactaagcgctgacagt
cccacccagcgggtgggcggccctccagctgaggggttcagcagcgttgagcaccgcatc
ggcatgctcagccttgataacgccttcaacgccgaagagttgcaggcctgggatgcacgc
ctggggcgccagctggaggacaaccctgagcgccagcgcgagtacgtctgcgagctcaag
atcgatggcaatgccttggccttgagctacgccgatggggtgctggtgcgcgccgccacc
cgcggtgatggcagtcgcggtgaggagatcaccgccaacgttcgcaccatccaagcggtg
ccgctgcggttgcagctcaagcaaccaccggcctgggtggaagtgcgcggcgaggccttc
atccccgacgacacttttgaggccatcaacgccgagcgccagcagcgcggggaagccctc
tttgccaatccgcgcaatgcctgcgcgggcaccctgcggcagctcgaccccaaggcggtg
gccgcccgacggctggacttcttcgcttacacggtgcacctgccagccgatgaaatgggg
cccaagagccaatgggatgctctgcaatggctggaaactgcgggcttccgcgtcaatccc
caccgcgaacgcaccagcggagccgatggcgtggtggccttctatgaccgctgggaggag
cagcgccatcagttgccttacgccaccgatggcgtggtggtgaagctcgatgcgctcgag
cgtcagcagctcgcgggcttcacgcaaaaggcgccgcgctgggccatcgccctgaaatac
gccgccgaagaagcccccagccggctcctgcgcctggtggcccaggtgggccgcactggg
gtggtgactcccgtggcggaatttgaagccgtgcccctggctggcaccagcgtcagccgc
gccaccttgcacaacgctgatcggctcgaggagctggatctccacagcggcgacacgatt
gtggtgcgcaaagccggcgagatcatcccggaagtgctgcgggtgctgcctgaactgcgg
cccgagggagccgaacagctagagctacccagccactgcccggaatgcggttccttgctg
gtgcgcgagagcggagaagccgccacccgctgcgtgaacagcagctgcccggccatcctg
cgcggtgctcttcgccattgggtgagccgtcaggcgatggatgtcgatggcttgggaggc
aaattgatcgaacagctcgtcgatcgcggcctggtgcgctccattgctgatctctaccgg
ctcgatgccgccctgctcgccagtctcgagcgcatgggtgagcaatcagccagcaacttg
attgaagcgcttgccgcctcacgccaacggccatggcaccggttgctctatgccctcggc
atccaccacatcggcagcgtcaatgccaaaacattagccgccgccttccctagctgggag
gcgctgcaaagcgccagcgaagaagcgctgaacgagctctatggcattggccccgagatc
agccaatccatgcagcagtggtgcagcaccgaggccaatcaaagcttgatggctgagctt
gcagccctagaactgccgctagccagcgacgacagcagtgcagagtccgctggtgccatc
ggcgctctaacgggtcaaaccctggtgctcaccggcacgctgcccaacctcagccgcctt
gaggcacaagctttgatcgaagccgcagggggcaaggtgacgggctcggtcagcaaaaag
accaactacgtggtggccggcagcgaagcaggcagcaaattgcaaaaagccgaaaagctt
ggggtcgccgtgattgatgaagccgagctcaaagcattgctgagctaa

DBGET integrated database retrieval system