Trichoplax adhaerens (placozoan): TRIADDRAFT_50330 Help Entry TRIADDRAFT_50330  CDS       T01069                                  Name (RefSeq) ring box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tad  Trichoplax adhaerens (placozoan) Pathway tad03420   Nucleotide excision repair tad04120   Ubiquitin mediated proteolysis tad04141   Protein processing in endoplasmic reticulum tad04310   Wnt signaling pathway tad04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:tad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     TRIADDRAFT_50330    04120 Ubiquitin mediated proteolysis     TRIADDRAFT_50330   09124 Replication and repair    03420 Nucleotide excision repair     TRIADDRAFT_50330  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     TRIADDRAFT_50330    04350 TGF-beta signaling pathway     TRIADDRAFT_50330  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tad04121]     TRIADDRAFT_50330    03400 DNA repair and recombination proteins [BR:tad03400]     TRIADDRAFT_50330 Enzymes [BR:tad01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      TRIADDRAFT_50330 Ubiquitin system [BR:tad04121]  Ubiquitin ligases (E3)   UBL E3 ligases    TRIADDRAFT_50330   Multi subunit type E3    SCF complex     Ring finger protein      TRIADDRAFT_50330    Cul2 complex      TRIADDRAFT_50330    Cul3 complex      TRIADDRAFT_50330    Cul4 complex      TRIADDRAFT_50330    Cul7 complex      TRIADDRAFT_50330    Cul8 complex      TRIADDRAFT_50330    Cul9 complex      TRIADDRAFT_50330 DNA repair and recombination proteins [BR:tad03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       TRIADDRAFT_50330     TCR (transcription coupled repair) factors      Cul4-CSA complex       TRIADDRAFT_50330 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 SCIFF Motif Other DBs NCBI-GeneID:  6753791 NCBI-ProteinID:  XP_002113018 JGI:  50330 UniProt:  B3RWG1 LinkDB All DBs AA seq 99 aa AA seqDB search MASNDVVSIKSEKKRFEVKKWNAVALWSWDIVVDNCAICRNHIMDLCIECQANQASATSD ECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSDWEFQK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcttccaacgatgttgtatcgataaaatcggagaagaaacgtttcgaagtgaaaaag tggaacgcagttgctttatggtcttgggatatcgttgtagacaactgcgctatttgccgt aatcatattatggatttatgtatagaatgtcaagctaaccaagcgtcagcaactagcgac gaatgtactgtagcttggggcgtttgtaaccacgcgttccactttcactgtatatcaaga tggctcaagactcgccaggtgtgccctttagataatagtgactgggaatttcaaaagtaa

DBGET integrated database retrieval system