Triticum aestivum (bread wheat): 123148027 Help Entry 123148027         CDS       T07757                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism taes  Triticum aestivum (bread wheat) Pathway taes00510   N-Glycan biosynthesis taes00513   Various types of N-glycan biosynthesis taes04141   Protein processing in endoplasmic reticulum Module taes_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:taes00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     123148027    00513 Various types of N-glycan biosynthesis     123148027  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123148027 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6338 Motif Other DBs NCBI-GeneID:  123148027 NCBI-ProteinID:  XP_044423316 LinkDB All DBs Position 7A:539897591..539900247 Genome browser AA seq 76 aa AA seqDB search MAAKAISSPVPVEWYPTLAVVMVSVGLMLTASFFIYEATTSRRNRSLAKEIVTASIASVF LGFGSLFVLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcggccaaggcgatctccagccccgtgccggtggaatggtacccgacgctggccgtc gtcatggtctccgtcggcctcatgctcaccgcatccttcttcatttatgaagccacgact tcaaggcggaaccgtagtttagcaaaggagattgtcacagcgtccattgcttccgtcttc ctgggctttggatctctcttcgtgctccttgcaagcggtgtttatgtctga

DBGET integrated database retrieval system