Triticum aestivum (bread wheat): 123172046 Help Entry 123172046         CDS       T07757                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism taes  Triticum aestivum (bread wheat) Pathway taes03420   Nucleotide excision repair taes04120   Ubiquitin mediated proteolysis taes04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:taes00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123172046    04120 Ubiquitin mediated proteolysis     123172046   09124 Replication and repair    03420 Nucleotide excision repair     123172046  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:taes04121]     123172046    03400 DNA repair and recombination proteins [BR:taes03400]     123172046 Enzymes [BR:taes01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      123172046 Ubiquitin system [BR:taes04121]  Ubiquitin ligases (E3)   UBL E3 ligases    123172046   Multi subunit type E3    SCF complex     Ring finger protein      123172046    Cul2 complex      123172046    Cul3 complex      123172046    Cul4 complex      123172046    Cul7 complex      123172046    Cul8 complex      123172046    Cul9 complex      123172046 DNA repair and recombination proteins [BR:taes03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       123172046     TCR (transcription coupled repair) factors      Cul4-CSA complex       123172046 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  123172046 NCBI-ProteinID:  XP_044445025 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MSAMETDAPDAAPPPAADAAASSSSSRKPGKRFEIKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtcggccatggagacggacgcccccgacgccgccccgccccccgccgccgacgccgcg gcctcctcctcctcgtcccgcaagccgggcaagcgcttcgagatcaagaagtggaacgcc gtcgcgctgtgggcgtgggacatcgtggtggacaactgcgccatctgccgcaaccacatc atggatctatgcatcgagtgccaggccaaccaggccagcgccaccagcgaggagtgcacc gtcgcatggggtgtctgcaatcatgctttccacttccactgcatcagcaggtggctcaag actcgccaagtgtgcccactagacaacagcgaatgggagttccagaaatacggccactag

DBGET integrated database retrieval system