Triticum aestivum (bread wheat): 123172497 Help Entry 123172497         CDS       T07757                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism taes  Triticum aestivum (bread wheat) Pathway taes03420   Nucleotide excision repair taes04120   Ubiquitin mediated proteolysis taes04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:taes00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123172497    04120 Ubiquitin mediated proteolysis     123172497   09124 Replication and repair    03420 Nucleotide excision repair     123172497  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:taes04121]     123172497    03400 DNA repair and recombination proteins [BR:taes03400]     123172497 Enzymes [BR:taes01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      123172497 Ubiquitin system [BR:taes04121]  Ubiquitin ligases (E3)   UBL E3 ligases    123172497   Multi subunit type E3    SCF complex     Ring finger protein      123172497    Cul2 complex      123172497    Cul3 complex      123172497    Cul4 complex      123172497    Cul7 complex      123172497    Cul8 complex      123172497    Cul9 complex      123172497 DNA repair and recombination proteins [BR:taes03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       123172497     TCR (transcription coupled repair) factors      Cul4-CSA complex       123172497 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  123172497 NCBI-ProteinID:  XP_044445395 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MSAMETDAPDAPPPAPAADAGAGSSSRKPGKRFEIKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtcggccatggagacggacgcccccgacgcgccgccgccggcccccgccgccgacgcc ggcgccgggtcgtcgtcccgcaagccgggcaagcgcttcgagatcaagaagtggaacgcc gtcgcgctttgggcgtgggacatcgtggtggacaactgcgccatctgccgcaaccacatc atggatctatgcatcgagtgccaggccaaccaggccagcgccaccagcgaggagtgcacc gtcgcatggggtgtctgtaatcatgctttccacttccactgcatcagcaggtggctcaag actcgccaagtgtgcccactagacaacagcgaatgggagttccagaaatacggccactag

DBGET integrated database retrieval system