Thermosipho africanus: THA_624 Help Entry THA_624           CDS       T00797                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism taf  Thermosipho africanus Pathway taf00670   One carbon pool by folate taf00790   Folate biosynthesis taf01100   Metabolic pathways taf01240   Biosynthesis of cofactors taf04981   Folate transport and metabolism Module taf_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:taf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     THA_624 (folA)    00670 One carbon pool by folate     THA_624 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     THA_624 (folA) Enzymes [BR:taf01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      THA_624 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 RibD_C Motif Other DBs NCBI-ProteinID:  ACJ75110 UniProt:  B7IG96 LinkDB All DBs Position complement(638477..638965) Genome browser AA seq 162 aa AA seqDB search MHLSMIVVTDIFGGFAISEYDKIEWGSKEDKAHFRELTSKIGTVIMGRKTYESIGFPLKD RLNIVLTSKNYKNSENLIFLNESPIQVIRFLEKNKINEAAVIGGKSVFKQFFPYIDKIYI TIEPITLENAEKLSFPYQQFKLISTNILNEKGTILLEYSKLQ NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgcatttatctatgattgttgttacagacatatttggaggttttgccatttctgaatac gataaaatagagtggggatctaaagaagataaagcgcactttagagaacttacatcaaag atcggaacagtaataatggggcgaaaaacgtacgaaagtattggttttcctctaaaagac cgcctaaatatcgttcttacaagtaaaaattacaaaaattcagaaaatcttattttttta aatgaatcaccaattcaagtaataagatttttggaaaaaaataaaattaatgaagctgca gttattggtggtaaatcagttttcaagcaattttttccatatattgataaaatttatatt acaattgaaccaattactcttgaaaatgcagaaaaactttcttttccatatcaacaattc aagttaatttcaactaatattttaaatgaaaaaggaaccattctcctagaatattcaaaa ttacaatga

DBGET integrated database retrieval system