Tyto alba (Barn owl): 104364152 Help Entry 104364152         CDS       T07816                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism tala  Tyto alba (Barn owl) Pathway tala03260   Virion - Human immunodeficiency virus tala03264   Virion - Flavivirus and Alphavirus tala03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus tala03273   Virion - Lassa virus and SFTS virus tala04145   Phagosome tala04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:tala00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     104364152    03264 Virion - Flavivirus and Alphavirus     104364152    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     104364152    03273 Virion - Lassa virus and SFTS virus     104364152  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104364152  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104364152  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tala04131]     104364152   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:tala04054]     104364152    04515 Cell adhesion molecules [BR:tala04515]     104364152    04090 CD molecules [BR:tala04090]     104364152    04091 Lectins [BR:tala04091]     104364152 Membrane trafficking [BR:tala04131]  Endocytosis   Phagocytosis    C-lectin receptors     104364152 Pattern recognition receptors [BR:tala04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    104364152 Cell adhesion molecules [BR:tala04515]  Lectins   Selectins and C-type lectins    104364152 CD molecules [BR:tala04090]  Proteins   104364152 Lectins [BR:tala04091]  C-Type lectins   Asialoglycoprotein and DC receptors    104364152 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  104364152 NCBI-ProteinID:  XP_032854383 LinkDB All DBs Position Unknown AA seq 181 aa AA seqDB search MVYLLLALSFLLIISLFAVSFSRVSDISSKLNEMHLERKQNVSGRDFPLFPCGPRSREWE YFDGKCYYFSLTRVSWYKAKAQCEEMHSQLAVINSYAKQNFVMFRTRNERFWIGLTDENS EGEWEWIDGTDYRTTFTFWKEGEPNNSGSNEDCAHVWISGKWNDVYCTYECYYICEKALP N NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggtctacttgctcctggccctctccttcttgctgatcatcagcctgtttgctgtgtcg ttctccagagtttcagacatttcttccaaactcaacgagatgcacctggaacggaagcag aacgtttctggcagggattttcccttgtttccctgcggacccagatccagggaatgggaa tactttgatggaaaatgttactacttctccctaaccagagtgagctggtacaaggcgaag gctcagtgtgaggagatgcactcgcagctggctgtcattaacagctatgccaagcagaat tttgtcatgttcaggacaaggaatgagcgtttctggatcgggctcacggacgagaattcg gaaggggaatgggaatggatcgacgggactgactatagaaccacgttcacattttggaag gagggagagcccaacaacagcggcagcaacgaagattgtgcccacgtctggatctccggg aagtggaacgacgtctactgcacctacgagtgctactacatctgcgaaaaggctctgccc aactga

DBGET integrated database retrieval system