Tyto alba (Barn owl): 104366358 Help Entry 104366358         CDS       T07816                                  Name (RefSeq) thymosin beta-4 isoform X2   KO K05764   thymosin, beta 4 Organism tala  Tyto alba (Barn owl) Pathway tala04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:tala00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104366358  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tala04812]     104366358 Cytoskeleton proteins [BR:tala04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      104366358 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thymosin Motif Other DBs NCBI-GeneID:  104366358 NCBI-ProteinID:  XP_009971578 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MGSGGGRRREERRDYPDLFQLTLPQTATKQLRREQPDGLIMSDKPDFAEIETFDRTKLKK TETREKNPLPTKETIEQEKQSESTA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgggctcgggcggggggaggagaagagaggagaggagggattaccctgacctttttcaa ctcacactgcctcagacggccaccaagcagctgaggagagagcagccagacggactcatc atgtccgacaaaccagattttgcagaaattgaaacgtttgacaggaccaagctgaagaag acagaaaccagagagaaaaatccattgcccactaaagaaactatcgaacaggaaaagcaa agtgaaagtacagcctga

DBGET integrated database retrieval system