Trichosporon asahii var. asahii: A1Q1_01005 Help Entry A1Q1_01005        CDS       T06566                                  Name (RefSeq) ubiquitin-protein ligase   KO K03094   S-phase kinase-associated protein 1 Organism tasa  Trichosporon asahii var. asahii Pathway tasa03083   Polycomb repressive complex tasa04111   Cell cycle - yeast tasa04120   Ubiquitin mediated proteolysis tasa04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tasa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     A1Q1_01005    04120 Ubiquitin mediated proteolysis     A1Q1_01005   09126 Chromosome    03083 Polycomb repressive complex     A1Q1_01005  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     A1Q1_01005  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tasa04131]     A1Q1_01005    04121 Ubiquitin system [BR:tasa04121]     A1Q1_01005    03036 Chromosome and associated proteins [BR:tasa03036]     A1Q1_01005 Membrane trafficking [BR:tasa04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     A1Q1_01005 Ubiquitin system [BR:tasa04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      A1Q1_01005    Cul7 complex      A1Q1_01005 Chromosome and associated proteins [BR:tasa03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      A1Q1_01005   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      A1Q1_01005 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  25984519 NCBI-ProteinID:  XP_014181103 UniProt:  J5QZ01 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MSDKKDQITLVTSDEETFNVDKKVAERSNLIKQMIEGEFTASSVLVKVLEYCDHHQNDPL PPSDSNDADDARRKATEISEWDAKFIQEMLFEIILAANYLDIKPLLDVGCKTVANMIKGK TPEEIRKLFNIVNDFTPEEEEQIRKENEWAEE NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaagaaggaccagatcaccctcgtgacctcggacgaggagacgttcaacgtc gacaagaaggttgccgagcgctccaacctcatcaagcagatgattgagggtgagttcact gcctcgagcgtcctcgtcaaggtcctcgagtactgcgaccaccaccagaacgaccccctg ccgccctcggactcgaatgacgccgacgacgcccgccgcaaggctaccgagatctccgag tgggacgccaagttcatccaggagatgctcttcgagatcatcctcgccgccaactacctc gacatcaagcccctccttgacgtcggatgcaagactgtcgccaacatgatcaagggcaag acgcccgaggagatccgcaagctcttcaacatcgtcaacgacttcactcccgaggaggag gagcagatccgcaaggagaacgagtgggccgaggagtaa

DBGET integrated database retrieval system