Trichosporon asahii var. asahii: A1Q1_01431 Help Entry A1Q1_01431        CDS       T06566                                  Name (RefSeq) rho1 GTPase   KO K04513   Ras homolog gene family, member A Organism tasa  Trichosporon asahii var. asahii Pathway tasa04011   MAPK signaling pathway - yeast tasa04081   Hormone signaling tasa04144   Endocytosis tasa05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:tasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     A1Q1_01431   09133 Signaling molecules and interaction    04081 Hormone signaling     A1Q1_01431  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     A1Q1_01431  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     A1Q1_01431  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tasa04131]     A1Q1_01431   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tasa04147]     A1Q1_01431    04031 GTP-binding proteins [BR:tasa04031]     A1Q1_01431 Membrane trafficking [BR:tasa04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     A1Q1_01431 Exosome [BR:tasa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    A1Q1_01431   Exosomal proteins of other body fluids (saliva and urine)    A1Q1_01431   Exosomal proteins of colorectal cancer cells    A1Q1_01431   Exosomal proteins of bladder cancer cells    A1Q1_01431 GTP-binding proteins [BR:tasa04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     A1Q1_01431 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU GGDEF Motif Other DBs NCBI-GeneID:  25984945 NCBI-ProteinID:  XP_014179945 UniProt:  J6F2W5 LinkDB All DBs Position Unknown AA seq 169 aa AA seqDB search MFPEVYVPTVFENYVADVEVDGRKVELALWDTAGQEDYDRLRPLSYPDSHVILICYAVDS PDSLDNVQEKWISEVKHFCSGLPIILVACKQDLRDDPKTIQDLARMNQRPVTRQEGQAVA QKIGATAYVECSAKNGTGVREVFQTATKAALSAKRQGKNGKPKKPCVVL NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atgttccccgaggtctacgtccccaccgtcttcgagaactacgttgccgatgtcgaggtc gatggcaggaaggttgagctggccctctgggataccgctggtcaggaggactacgaccgt ctccgtcccctgtcgtaccccgactcgcacgtcatccttatctgttatgcggtcgactcg cccgactcgctggacaacgttcaagaaaagtggatttccgaggtcaagcacttctgttcg ggacttcccatcatcctcgtcgcgtgcaagcaggacctgcgtgacgacccgaagaccatc caggacctcgcccgcatgaaccagcgccccgtcaccaggcaggaggggcaggccgttgcc cagaagatcggagctaccgcctacgtcgagtgctcggccaagaacggaaccggtgttcgc gaggtcttccagacggccaccaaggctgccctgtcggccaagaggcagggaaagaacggc aagcccaagaagccttgcgtcgtcctctag

DBGET integrated database retrieval system