Trichosporon asahii var. asahii: A1Q1_06827 Help Entry A1Q1_06827        CDS       T06566                                  Name (RefSeq) microtubule binding protein   KO K08341   GABA(A) receptor-associated protein Organism tasa  Trichosporon asahii var. asahii Pathway tasa04136   Autophagy - other tasa04138   Autophagy - yeast tasa04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:tasa00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     A1Q1_06827    04136 Autophagy - other     A1Q1_06827    04139 Mitophagy - yeast     A1Q1_06827  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tasa04131]     A1Q1_06827    04121 Ubiquitin system [BR:tasa04121]     A1Q1_06827    03029 Mitochondrial biogenesis [BR:tasa03029]     A1Q1_06827 Membrane trafficking [BR:tasa04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     A1Q1_06827 Ubiquitin system [BR:tasa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    A1Q1_06827 Mitochondrial biogenesis [BR:tasa03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     A1Q1_06827 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 Motif Other DBs NCBI-GeneID:  25990339 NCBI-ProteinID:  XP_014182551 UniProt:  J5RCW9 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MVRSKFKDEHPFDKRKAEAERIRQKYSDRIPVICEKVEKSDIPTIDKKKYLVPARIKLSP EKAIFIFVDDILPPTAALMSAIYEEHKDEDGKLAPAHVDG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggtccgctccaagttcaaggacgagcacccctttgacaagcgtaaggctgaggccgag cgtatccgccagaagtactcggaccgcattcctgtcatctgtgagaaggtcgagaagagc gacatccccacgatcgacaagaagaagtacctcgtcccggctcgcatcaagctgtctccc gagaaggcgatcttcatctttgtcgatgacattctcccgccgacggccgccctcatgagc gccatctacgaggagcacaaggacgaggacggtaagcttgctccagcacatgtcgacgga tag

DBGET integrated database retrieval system