Tribolium castaneum (red flour beetle): 657695 Help Entry 657695            CDS       T01046                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism tca  Tribolium castaneum (red flour beetle) Pathway tca03008   Ribosome biogenesis in eukaryotes tca03013   Nucleocytoplasmic transport tca03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:tca00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     657695    03008 Ribosome biogenesis in eukaryotes     657695   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     657695  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tca03019]     657695    03009 Ribosome biogenesis [BR:tca03009]     657695    03016 Transfer RNA biogenesis [BR:tca03016]     657695    03036 Chromosome and associated proteins [BR:tca03036]     657695   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tca04147]     657695    04031 GTP-binding proteins [BR:tca04031]     657695 Messenger RNA biogenesis [BR:tca03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      657695 Ribosome biogenesis [BR:tca03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     657695   Pre-60S particles     657695 Transfer RNA biogenesis [BR:tca03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     657695 Chromosome and associated proteins [BR:tca03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      657695    Spindle formation proteins     657695 Exosome [BR:tca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    657695 GTP-binding proteins [BR:tca04031]  Small (monomeric) G-proteins   Ran Family    Ran     657695 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RNA_helicase Gtr1_RagA AAA_24 ArgoMid AAA_7 AAA_16 Pox_A32 DAP3 DUF5906 TsaE Motif Other DBs NCBI-GeneID:  657695 NCBI-ProteinID:  XP_966512 UniProt:  D6X0G0 LinkDB All DBs Position LG9:14996687..14998019 Genome browser AA seq 215 aa AA seqDB search MAQEQEMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIRF NVWDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA LVPPEVTMDPHWQQQIEKDLKEAQETALPEDDEEL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcccaggagcaggaaatgccgaccttcaagtgcgtcctagtcggagacgggggcact ggcaagaccaccttcgtcaagcggcacttgacgggcgagttcgagaagaagtacgtcgcg acgctcggcgtggaggtgcacccgctggtgttccacaccaaccggggggccatcaggttc aacgtgtgggacacggccggccaggagaagtttggggggctgcgcgacggctactacatc caggggcagtgcgccatcatcatgttcgacgtcacgtcgcgagtcacctacaaaaacgtc cccaactggcacagagacctggtgcgggtgtgcgagaacatccccattgtgctgtgcggc aacaaagtcgacatcaaagaccgcaaggtcaaggcgaaaagtattgtgttccacaggaag aagaaccttcagtactacgatatctccgccaaatcgaattacaacttcgaaaagccgttc ctgtggttggcgcgcaaactaatcggtgatcctaatctagagtttgtggcgatgcccgca ctggtgcccccagaagtcacaatggacccccattggcagcaacaaatcgaaaaagatctc aaggaggctcaagaaaccgcgcttcccgaggatgatgaagaactttaa

DBGET integrated database retrieval system