Theobroma cacao (cacao): 18588272 Help Entry 18588272          CDS       T02994                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tcc  Theobroma cacao (cacao) Pathway tcc03420   Nucleotide excision repair tcc04120   Ubiquitin mediated proteolysis tcc04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tcc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     18588272    04120 Ubiquitin mediated proteolysis     18588272   09124 Replication and repair    03420 Nucleotide excision repair     18588272  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tcc04121]     18588272    03400 DNA repair and recombination proteins [BR:tcc03400]     18588272 Enzymes [BR:tcc01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      18588272 Ubiquitin system [BR:tcc04121]  Ubiquitin ligases (E3)   UBL E3 ligases    18588272   Multi subunit type E3    SCF complex     Ring finger protein      18588272    Cul2 complex      18588272    Cul3 complex      18588272    Cul4 complex      18588272    Cul7 complex      18588272    Cul8 complex      18588272    Cul9 complex      18588272 DNA repair and recombination proteins [BR:tcc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       18588272     TCR (transcription coupled repair) factors      Cul4-CSA complex       18588272 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  18588272 NCBI-ProteinID:  XP_017981977 UniProt:  A0AB32WQR3 A0A061GK71 LinkDB All DBs Position 9:complement(3932282..3934599) Genome browser AA seq 118 aa AA seqDB search MATLDSDVPMVPVGEASSSTAPSSSTKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctactctagactccgatgttccgatggttccagttggcgaggcttccagcagcacc gccccttcctcctccactaagaagcccaagcgcttcgagatcaaaaagtggagtgccgtt gcgctctgggcctgggatattgtcgtggataattgtgcaatttgcaggaatcacatcatg gatctatgtatcgaatgtcaagccaaccaagccagcgccaccagtgaggaatgcactgtt gcttggggggtctgcaaccatgcatttcacttccactgcatcagccgatggctcaagact cggcaagtgtgtccactggataacagtgagtgggagttccaaaagtatggtcactag

DBGET integrated database retrieval system