Thermococcus celer: A3L02_02525 Help Entry A3L02_02525       CDS       T05076                                  Name (GenBank) lipoate--protein ligase   KO K03800   lipoate---protein ligase [EC:6.3.1.20] Organism tce  Thermococcus celer Pathway tce00785   Lipoic acid metabolism tce01100   Metabolic pathways tce01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:tce00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     A3L02_02525 Enzymes [BR:tce01000]  6. Ligases   6.3  Forming carbon-nitrogen bonds    6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)     6.3.1.20  lipoate---protein ligase      A3L02_02525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lip_prot_lig_C Citrate_synth_N DUF3769 Motif Other DBs NCBI-ProteinID:  ASI98520 UniProt:  A0A218P0R1 LinkDB All DBs Position 457317..457595 Genome browser AA seq 92 aa AA seqDB search MRHHVGEHKAKKGLIRIEFDERDGKAERVRITGDFFMHPEEAVQELERKLEGHRLEELEQ LIDEFFAVRMDLETPYVNVEDFKIALKNALKE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagacaccacgttggggagcacaaggctaagaagggactgataaggatagagttcgac gagagggacgggaaggctgagagagtcaggatcaccggggatttcttcatgcatccggag gaggctgttcaggagctcgaaaggaagcttgaagggcacaggctggaggaactggagcaa cttatagacgagttcttcgcggttaggatggacttggagaccccctacgttaacgtcgag gacttcaagatagcccttaaaaacgccctgaaggagtga

DBGET integrated database retrieval system