Triticum dicoccoides (wild emmer wheat): 119266566 Help Entry 119266566         CDS       T07278                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc03420   Nucleotide excision repair tdc04120   Ubiquitin mediated proteolysis tdc04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     119266566    04120 Ubiquitin mediated proteolysis     119266566   09124 Replication and repair    03420 Nucleotide excision repair     119266566  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tdc04121]     119266566    03400 DNA repair and recombination proteins [BR:tdc03400]     119266566 Enzymes [BR:tdc01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      119266566 Ubiquitin system [BR:tdc04121]  Ubiquitin ligases (E3)   UBL E3 ligases    119266566   Multi subunit type E3    SCF complex     Ring finger protein      119266566    Cul2 complex      119266566    Cul3 complex      119266566    Cul4 complex      119266566    Cul7 complex      119266566    Cul8 complex      119266566    Cul9 complex      119266566 DNA repair and recombination proteins [BR:tdc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       119266566     TCR (transcription coupled repair) factors      Cul4-CSA complex       119266566 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  119266566 NCBI-ProteinID:  XP_037403696 LinkDB All DBs Position 3A:264121..266794 Genome browser AA seq 119 aa AA seqDB search MSAMETDAPDAAPPPAADAAASSSSSRKPGKRFEIKKWNAVALWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtcggccatggagacggacgcccccgacgccgccccgccccccgccgccgacgccgcg gcctcctcctcctcgtcccgcaagccgggcaagcgcttcgagatcaagaagtggaacgcc gtcgcgctgtgggcgtgggacatcgtggtggacaactgcgccatctgccgcaaccacatc atggatctatgcatcgagtgccaggccaaccaggccagcgccaccagtgaggagtgcacc gtcgcatggggtgtctgcaatcatgctttccacttccactgcatcagcaggtggctcaag actcgccaagtgtgcccactagacaacagcgaatgggagttccagaaatacggccactag

DBGET integrated database retrieval system