Triticum dicoccoides (wild emmer wheat): 119274241 Help Entry 119274241         CDS       T07278                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc03420   Nucleotide excision repair tdc04120   Ubiquitin mediated proteolysis tdc04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     119274241    04120 Ubiquitin mediated proteolysis     119274241   09124 Replication and repair    03420 Nucleotide excision repair     119274241  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tdc04121]     119274241    03400 DNA repair and recombination proteins [BR:tdc03400]     119274241 Enzymes [BR:tdc01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      119274241 Ubiquitin system [BR:tdc04121]  Ubiquitin ligases (E3)   UBL E3 ligases    119274241   Multi subunit type E3    SCF complex     Ring finger protein      119274241    Cul2 complex      119274241    Cul3 complex      119274241    Cul4 complex      119274241    Cul7 complex      119274241    Cul8 complex      119274241    Cul9 complex      119274241 DNA repair and recombination proteins [BR:tdc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       119274241     TCR (transcription coupled repair) factors      Cul4-CSA complex       119274241 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  119274241 NCBI-ProteinID:  XP_037410805 LinkDB All DBs Position 3B:complement(1962384..1965058) Genome browser AA seq 125 aa AA seqDB search MSAMETDAPDAPPPAAPAPAADAGAGSSSSSSRKPGKRFEIKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgtcggccatggagacggacgcccccgacgcgccgccgccggccgccccggcccccgcc gccgacgccggcgccgggtcttcgtcctcgtcgtcccgcaagccgggcaagcgcttcgag atcaagaagtggaacgccgtcgcgctctgggcgtgggacatcgtggtggacaactgcgcc atctgccgtaaccacatcatggatctatgcatcgagtgccaggccaaccaggccagcgcc accagcgaggaatgcaccgtcgcatggggtgtctgtaatcatgctttccacttccactgc atcagcaggtggctcaagactcgccaagtgtgcccactagacaacagcgaatgggagttc cagaaatacggccactag

DBGET integrated database retrieval system