Triticum dicoccoides (wild emmer wheat): 119280969 Help Entry 119280969         CDS       T07278                                  Name (RefSeq) sm-like protein LSM3A   KO K12622   U6 snRNA-associated Sm-like protein LSm3 Organism tdc  Triticum dicoccoides (wild emmer wheat) Pathway tdc03018   RNA degradation tdc03040   Spliceosome Brite KEGG Orthology (KO) [BR:tdc00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     119280969   09123 Folding, sorting and degradation    03018 RNA degradation     119280969  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tdc03019]     119280969    03041 Spliceosome [BR:tdc03041]     119280969 Messenger RNA biogenesis [BR:tdc03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      119280969   mRNA degradation factors    5'-3' decay     Lsm complex      119280969 Spliceosome [BR:tdc03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     119280969  Complex C   U2 snRNP components     119280969 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM TIG_SUH Glutaredoxin Motif Other DBs NCBI-GeneID:  119280969 NCBI-ProteinID:  XP_037417536 LinkDB All DBs Position 1A:480780814..480783297 Genome browser AA seq 97 aa AA seqDB search MASEEDVAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEEIVTSIE IDDETYEEIVRTSKRTIPYLFVRGDGVILVSPPLRTV NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcgtcggaggaggatgtggcggtgaaggagccgctggatctcatacggctcagcctc gacgagcgcatctacgtcaagctccgctccgaccgcgagctccgcggcaagctccatgct tacgatcaacatctcaatatgatacttggagatgtagaagagatagtgacttccattgaa attgatgatgagacttacgaggagattgttcgtaccagcaagcgcaccatcccctacctt tttgtccgaggagatggcgtgatactggtttcgccgcccttgcggaccgtctga

DBGET integrated database retrieval system