Triplophysa dalaica: 130438502 Help Entry 130438502         CDS       T09616                                  Symbol ran Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism tdw  Triplophysa dalaica Pathway tdw03008   Ribosome biogenesis in eukaryotes tdw03013   Nucleocytoplasmic transport tdw03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:tdw00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     130438502 (ran)    03008 Ribosome biogenesis in eukaryotes     130438502 (ran)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     130438502 (ran)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tdw03019]     130438502 (ran)    03009 Ribosome biogenesis [BR:tdw03009]     130438502 (ran)    03016 Transfer RNA biogenesis [BR:tdw03016]     130438502 (ran)    03036 Chromosome and associated proteins [BR:tdw03036]     130438502 (ran)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tdw04147]     130438502 (ran)    04031 GTP-binding proteins [BR:tdw04031]     130438502 (ran) Messenger RNA biogenesis [BR:tdw03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      130438502 (ran) Ribosome biogenesis [BR:tdw03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     130438502 (ran)   Pre-60S particles     130438502 (ran) Transfer RNA biogenesis [BR:tdw03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     130438502 (ran) Chromosome and associated proteins [BR:tdw03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      130438502 (ran)    Spindle formation proteins     130438502 (ran) Exosome [BR:tdw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130438502 (ran) GTP-binding proteins [BR:tdw04031]  Small (monomeric) G-proteins   Ran Family    Ran     130438502 (ran) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha RNA_helicase AAA_24 Gtr1_RagA Pox_A32 ArgoMid AAA_7 Septin TsaE AAA_16 AAA_22 DUF5906 SRPRB AAA_33 Motif Other DBs NCBI-GeneID:  130438502 NCBI-ProteinID:  XP_056626417 LinkDB All DBs Position 16:complement(14629999..14632958) Genome browser AA seq 215 aa AA seqDB search MAENEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKY NVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVEMPA LAPPEIAMDPSLAAQYEHDLKVASETALPDEDDDL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcagagaacgagccacaggttcagtttaagctggttctggtaggagatggaggtacg gggaaaaccacctttgtaaagagacatttgactggggagtttgaaaagaaatatgttgcc acacttggagttgaggtacatcccctggtcttccacaccaacagaggagccatcaaatat aatgtctgggacacagctggacaggagaagtttggaggcctgagagatggttattacata caggctcagtgtgcaatcatcatgtttgatgtaacctctcgagtgacctacaaaaacgta cccaactggcatcgtgacttggtgcgtgtgtgcgagaacattcccatagtgctgtgtggt aacaaagtggacatcaaggacaggaaggttaaagcaaagagcatcgtgttccatcgtaag aagaacctacagtactacgacatctccgccaagagtaattataattttgagaagcccttc ctgtggcttgcacggaaactcattggtgatcctaacctggagtttgttgagatgcctgcc cttgccccacctgaaattgctatggacccatcgcttgctgcacaatacgagcatgacctg aaagtggcatcagaaacagctctcccagatgaagatgacgacctttaa

DBGET integrated database retrieval system