Tachysurus fulvidraco (yellow catfish): 113647824 Help Entry 113647824         CDS       T08119                                  Symbol ran Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd03008   Ribosome biogenesis in eukaryotes tfd03013   Nucleocytoplasmic transport tfd03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:tfd00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     113647824 (ran)    03008 Ribosome biogenesis in eukaryotes     113647824 (ran)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     113647824 (ran)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tfd03019]     113647824 (ran)    03009 Ribosome biogenesis [BR:tfd03009]     113647824 (ran)    03016 Transfer RNA biogenesis [BR:tfd03016]     113647824 (ran)    03036 Chromosome and associated proteins [BR:tfd03036]     113647824 (ran)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tfd04147]     113647824 (ran)    04031 GTP-binding proteins [BR:tfd04031]     113647824 (ran) Messenger RNA biogenesis [BR:tfd03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      113647824 (ran) Ribosome biogenesis [BR:tfd03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     113647824 (ran)   Pre-60S particles     113647824 (ran) Transfer RNA biogenesis [BR:tfd03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     113647824 (ran) Chromosome and associated proteins [BR:tfd03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      113647824 (ran)    Spindle formation proteins     113647824 (ran) Exosome [BR:tfd04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113647824 (ran) GTP-binding proteins [BR:tfd04031]  Small (monomeric) G-proteins   Ran Family    Ran     113647824 (ran) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha RNA_helicase AAA_24 Gtr1_RagA Pox_A32 ArgoMid AAA_7 Septin AAA_16 AAA_22 TsaE DUF5906 SRPRB AAA_33 Motif Other DBs NCBI-GeneID:  113647824 NCBI-ProteinID:  XP_027010582 LinkDB All DBs Position 17:5048146..5051054 Genome browser AA seq 215 aa AA seqDB search MAENDPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKY NVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVEMPA LAPPEIAMDPSLAAQYEHDLKVASETALPDEDDDL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaacgacccacaggttcagtttaagcttgttcttgttggagatggaggtaca ggaaagaccacctttgtgaagagacacttgacaggagagtttgaaaagaaatatgttgca actctgggtgttgaagtgcatcccttggttttccacaccaacaggggtgctatcaagtac aatgtatgggacacagcaggacaggagaagttcggaggcctgcgagacggatattatatt caagctcagtgtgcaatcatcatgtttgacgtgacctctcgagtgacttacaagaatgtt cccaactggcatcgtgacctggtgcgtgtgtgtgagaacattccaatagtactgtgcggc aacaaagtggacatcaaagaccggaaggtgaaagctaagagcattgtgttccaccgcaag aagaacctacagtactatgacatctccgccaagagtaattataactttgagaagcctttc ctgtggcttgcacgaaagctgattggagatcccaacttggagtttgtggagatgcctgcc ctagccccacccgaaatcgccatggacccatcacttgctgcacagtatgagcatgacctg aaagtggcatcagaaacggctctcccagatgaggacgacgacctctaa

DBGET integrated database retrieval system