Tachysurus fulvidraco (yellow catfish): 113661640 Help Entry 113661640         CDS       T08119                                  Symbol il6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism tfd  Tachysurus fulvidraco (yellow catfish) Pathway tfd04060   Cytokine-cytokine receptor interaction tfd04068   FoxO signaling pathway tfd04218   Cellular senescence tfd04620   Toll-like receptor signaling pathway tfd04621   NOD-like receptor signaling pathway tfd04623   Cytosolic DNA-sensing pathway tfd04625   C-type lectin receptor signaling pathway tfd04672   Intestinal immune network for IgA production tfd05132   Salmonella infection tfd05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:tfd00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     113661640 (il6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113661640 (il6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     113661640 (il6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113661640 (il6)    04621 NOD-like receptor signaling pathway     113661640 (il6)    04623 Cytosolic DNA-sensing pathway     113661640 (il6)    04625 C-type lectin receptor signaling pathway     113661640 (il6)    04672 Intestinal immune network for IgA production     113661640 (il6)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     113661640 (il6)   09171 Infectious disease: bacterial    05132 Salmonella infection     113661640 (il6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tfd04052]     113661640 (il6) Cytokines and neuropeptides [BR:tfd04052]  Cytokines   Interleukins    113661640 (il6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL23 IL11 Motif Other DBs NCBI-GeneID:  113661640 NCBI-ProteinID:  XP_027031814 LinkDB All DBs Position 24:6045123..6049053 Genome browser AA seq 198 aa AA seqDB search MDFYETSGSELQNEAHAPDQKWVDVAKQLRNEVKNARDEQFHSAIGGTQNTTIYAYKGIK MPILNDSDGCLRSDFNAQKCLRLIYTGLRVYQVNMPHLEQDSQFITNVLNIKAGTYRLLH LIKETVKVNDEKVPQVDLSEFPDTAWNQNIIAHSILHSFTDFMTEASRAINYMKNKKLMR QHLKEDKKVDKWISKHQQ NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggatttctatgaaacatctggatccgagctgcagaatgaagctcacgctccagaccag aagtgggttgacgtcgccaaacagctgcggaatgaagttaaaaacgctcgcgatgagcag tttcatagtgccatcggaggaacacagaacacgactatttacgcctataaggggattaag atgccgatcctcaatgattcagacggatgtttgcgctctgatttcaatgcacaaaaatgt ctgcgccttatctacaccggtttgcgggtgtaccaggttaacatgcctcacctagagcag gacagccagtttataaccaacgtactgaatattaaagcggggacctacagattgctacat ttaattaaagaaacagtaaaagtaaacgatgagaaagttcctcaagtggatttgagtgaa tttccagatacagcatggaatcagaatataatcgcacactccattctgcacagcttcaca gacttcatgaccgaagccagcagagcgattaattacatgaagaataagaaattaatgaga caacaccttaaagaggacaagaaggtggacaagtggatctcaaaacaccagcaatga

DBGET integrated database retrieval system