Takifugu flavidus (sansaifugu): 130514717 Help Entry 130514717         CDS       T09160                                  Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs03420   Nucleotide excision repair tfs04110   Cell cycle tfs04114   Oocyte meiosis tfs04120   Ubiquitin mediated proteolysis tfs04141   Protein processing in endoplasmic reticulum tfs04310   Wnt signaling pathway tfs04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:tfs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130514717    04120 Ubiquitin mediated proteolysis     130514717   09124 Replication and repair    03420 Nucleotide excision repair     130514717  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     130514717    04350 TGF-beta signaling pathway     130514717  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     130514717    04114 Oocyte meiosis     130514717  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tfs04121]     130514717    03400 DNA repair and recombination proteins [BR:tfs03400]     130514717 Enzymes [BR:tfs01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      130514717 Ubiquitin system [BR:tfs04121]  Ubiquitin ligases (E3)   UBL E3 ligases    130514717   Multi subunit type E3    SCF complex     Ring finger protein      130514717    Cul2 complex      130514717    Cul3 complex      130514717    Cul4 complex      130514717    Cul7 complex      130514717    Cul8 complex      130514717    Cul9 complex      130514717 DNA repair and recombination proteins [BR:tfs03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       130514717     TCR (transcription coupled repair) factors      Cul4-CSA complex       130514717 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  130514717 NCBI-ProteinID:  XP_056870457 LinkDB All DBs Position 18:3819153..3821362 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPTGANSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctgccgcgatggacgttgacacaccgactggcgcaaacagtggagccagcaaaaag cgttttgaagttaaaaagtggaacgccgtcgcgctgtgggcctgggacattgtggtggat aactgtgcaatctgtaggaaccacattatggatctctgtatagaatgccaggccaaccag gcttctgccacgtctgaggagtgcaccgtggcctggggcgtgtgcaatcatgctttccac ttccactgcatctctcgctggttgaaaaccagacaggtgtgcccgctggacaacagggag tgggaatttcagaaatatggacattag

DBGET integrated database retrieval system