Torulaspora globosa: HG536_0E02510 Help Entry HG536_0E02510     CDS       T06981                                  Name (RefSeq) uncharacterized protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tgb  Torulaspora globosa Pathway tgb03420   Nucleotide excision repair tgb04111   Cell cycle - yeast tgb04120   Ubiquitin mediated proteolysis tgb04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tgb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     HG536_0E02510    04120 Ubiquitin mediated proteolysis     HG536_0E02510   09124 Replication and repair    03420 Nucleotide excision repair     HG536_0E02510  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     HG536_0E02510  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tgb04121]     HG536_0E02510    03400 DNA repair and recombination proteins [BR:tgb03400]     HG536_0E02510 Enzymes [BR:tgb01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      HG536_0E02510 Ubiquitin system [BR:tgb04121]  Ubiquitin ligases (E3)   UBL E3 ligases    HG536_0E02510   Multi subunit type E3    SCF complex     Ring finger protein      HG536_0E02510    Cul2 complex      HG536_0E02510    Cul3 complex      HG536_0E02510    Cul4 complex      HG536_0E02510    Cul7 complex      HG536_0E02510    Cul8 complex      HG536_0E02510    Cul9 complex      HG536_0E02510 DNA repair and recombination proteins [BR:tgb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       HG536_0E02510     TCR (transcription coupled repair) factors      Cul4-CSA complex       HG536_0E02510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-RING_11 zf-C3HC4_4 PHD_NSD Motif Other DBs NCBI-GeneID:  59326536 NCBI-ProteinID:  XP_037140014 UniProt:  A0A7G3ZIK4 LinkDB All DBs Position 5:complement(450355..450711) Genome browser AA seq 118 aa AA seqDB search MSEEDKMEVDSDVVEQRSSEVPQATKTKPKRFEIKKWTAVAFWSWDIAVDNCAICRNHIM EPCIECQPLAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDACPLDNQPWQLARCGR NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagaggataagatggaggtggactcggacgtggtggaacagcgttcgtccgag gttccgcaggcgacgaagacgaaacccaagaggtttgagatcaagaaatggacggctgtg gcgttttggtcttgggatattgctgtggacaattgcgctatctgcaggaatcatattatg gagccttgcattgaatgccagcctctagccatgacagataccgataacgaatgcgtagca gcctggggtacgtgtaaccacgccttccacctacattgcatcaataagtggatcaagacc agagatgcgtgtccgctggataaccagccgtggcagctggccagatgcgggcgatag

DBGET integrated database retrieval system