Theropithecus gelada (gelada): 112608413 Help Entry 112608413         CDS       T08041                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04151   PI3K-Akt signaling pathway tge04217   Necroptosis tge04380   Osteoclast differentiation tge04620   Toll-like receptor signaling pathway tge04621   NOD-like receptor signaling pathway tge04622   RIG-I-like receptor signaling pathway tge04623   Cytosolic DNA-sensing pathway tge04630   JAK-STAT signaling pathway tge04650   Natural killer cell mediated cytotoxicity tge04668   TNF signaling pathway tge04936   Alcoholic liver disease tge05135   Yersinia infection tge05142   Chagas disease tge05152   Tuberculosis tge05160   Hepatitis C tge05161   Hepatitis B tge05162   Measles tge05163   Human cytomegalovirus infection tge05164   Influenza A tge05165   Human papillomavirus infection tge05167   Kaposi sarcoma-associated herpesvirus infection tge05168   Herpes simplex virus 1 infection tge05169   Epstein-Barr virus infection tge05170   Human immunodeficiency virus 1 infection tge05171   Coronavirus disease - COVID-19 tge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112608413 (IFNB1)    04668 TNF signaling pathway     112608413 (IFNB1)    04151 PI3K-Akt signaling pathway     112608413 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112608413 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112608413 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112608413 (IFNB1)    04621 NOD-like receptor signaling pathway     112608413 (IFNB1)    04622 RIG-I-like receptor signaling pathway     112608413 (IFNB1)    04623 Cytosolic DNA-sensing pathway     112608413 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     112608413 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     112608413 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112608413 (IFNB1)    05161 Hepatitis B     112608413 (IFNB1)    05160 Hepatitis C     112608413 (IFNB1)    05171 Coronavirus disease - COVID-19     112608413 (IFNB1)    05164 Influenza A     112608413 (IFNB1)    05162 Measles     112608413 (IFNB1)    05168 Herpes simplex virus 1 infection     112608413 (IFNB1)    05163 Human cytomegalovirus infection     112608413 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     112608413 (IFNB1)    05169 Epstein-Barr virus infection     112608413 (IFNB1)    05165 Human papillomavirus infection     112608413 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     112608413 (IFNB1)    05152 Tuberculosis     112608413 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     112608413 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112608413 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112608413 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112608413 (IFNB1) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Interferons    112608413 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  112608413 NCBI-ProteinID:  XP_025216095 Ensembl:  ENSTGEG00000013564 UniProt:  A0A8D2F6Y1 LinkDB All DBs Position 15:60634160..60656935 Genome browser AA seq 187 aa AA seqDB search MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFD IPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLANVYHQIDHLK TILEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFVFINK LTGYLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacggctctt tccatgagctacaacttgcttggattcctacaaagaagcagcagttttcagtgtcagaag ctcctgtggcaattgaatggaaggcttgaatattgcctcaaggacaggatgaactttgac atccctgaggaaattaagcagccgcagcagttccagaaggaggacgctgcattgaccatc tatgagatgctccagaacatcttcgctattttcagacaagatttatctagcactggctgg aatgagactattgtggagaacctccttgctaatgtctatcatcagatagaccatctgaag acaatcctagaagaaaaactggagaaagaagatttcaccaggggaaaattcatgagcagt ctgcacctgaaaagatactatggaaggattctgcattacctgaaggccaaggagtacagt cactgtgcctggaccatagtcagagtggaaatcctcaggaactttgtcttcattaacaaa cttacaggttacctccgaaactga

DBGET integrated database retrieval system