Theropithecus gelada (gelada): 112611351 Help Entry 112611351         CDS       T08041                                  Name (RefSeq) actin, cytoplasmic 1 isoform X1   KO K05692   actin beta/gamma 1 Organism tge  Theropithecus gelada (gelada) Pathway tge03082   ATP-dependent chromatin remodeling tge04015   Rap1 signaling pathway tge04145   Phagocytosis tge04210   Apoptosis tge04390   Hippo signaling pathway tge04510   Focal adhesion tge04517   IgSF CAM signaling tge04518   Integrin signaling tge04519   Cadherin signaling tge04520   Adherens junction tge04530   Tight junction tge04611   Platelet activation tge04613   Neutrophil extracellular trap formation tge04670   Leukocyte transendothelial migration tge04714   Thermogenesis tge04810   Regulation of actin cytoskeleton tge04814   Motor proteins tge04820   Cytoskeleton in muscle cells tge04919   Thyroid hormone signaling pathway tge04921   Oxytocin signaling pathway tge04971   Gastric acid secretion tge05014   Amyotrophic lateral sclerosis tge05100   Bacterial invasion of epithelial cells tge05132   Salmonella infection tge05135   Yersinia infection tge05164   Influenza A tge05205   Proteoglycans in cancer tge05225   Hepatocellular carcinoma tge05410   Hypertrophic cardiomyopathy tge05412   Arrhythmogenic right ventricular cardiomyopathy tge05414   Dilated cardiomyopathy tge05416   Viral myocarditis tge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     112611351  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112611351    04390 Hippo signaling pathway     112611351   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     112611351    04518 Integrin signaling     112611351    04519 Cadherin signaling     112611351  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     112611351   09143 Cell growth and death    04210 Apoptosis     112611351   09144 Cellular community - eukaryotes    04510 Focal adhesion     112611351    04520 Adherens junction     112611351    04530 Tight junction     112611351   09142 Cell motility    04814 Motor proteins     112611351    04820 Cytoskeleton in muscle cells     112611351    04810 Regulation of actin cytoskeleton     112611351  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     112611351    04613 Neutrophil extracellular trap formation     112611351    04670 Leukocyte transendothelial migration     112611351   09152 Endocrine system    04921 Oxytocin signaling pathway     112611351    04919 Thyroid hormone signaling pathway     112611351   09154 Digestive system    04971 Gastric acid secretion     112611351   09159 Environmental adaptation    04714 Thermogenesis     112611351  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     112611351   09162 Cancer: specific types    05225 Hepatocellular carcinoma     112611351   09172 Infectious disease: viral    05164 Influenza A     112611351   09171 Infectious disease: bacterial    05132 Salmonella infection     112611351    05135 Yersinia infection     112611351    05100 Bacterial invasion of epithelial cells     112611351   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112611351   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112611351    05410 Hypertrophic cardiomyopathy     112611351    05412 Arrhythmogenic right ventricular cardiomyopathy     112611351    05414 Dilated cardiomyopathy     112611351    05416 Viral myocarditis     112611351  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tge03021]     112611351    03019 Messenger RNA biogenesis [BR:tge03019]     112611351    03036 Chromosome and associated proteins [BR:tge03036]     112611351    03029 Mitochondrial biogenesis [BR:tge03029]     112611351   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tge04812]     112611351    04147 Exosome [BR:tge04147]     112611351 Transcription machinery [BR:tge03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      112611351 Messenger RNA biogenesis [BR:tge03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      112611351 Chromosome and associated proteins [BR:tge03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      112611351     NuA4 complex      112611351   Chromatin remodeling factors    BAF complex     112611351    PBAF complex     112611351    GBAF(ncBAF) complex     112611351    SWR1 complex     112611351 Mitochondrial biogenesis [BR:tge03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     112611351 Cytoskeleton proteins [BR:tge04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      112611351 Exosome [BR:tge04147]  Exosomal proteins   Proteins found in most exosomes    112611351 SSDB OrthologParalogGFIT Motif Pfam:  Actin DUF6581 Motif Other DBs NCBI-GeneID:  112611351 NCBI-ProteinID:  XP_025220883 LinkDB All DBs Position 1:56519346..56559048 Genome browser AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgatgatatcgccgcgctcgttgtcgacaacggctccggcatgtgcaaggccggc ttcgcgggcgacgatgcaccccgggccgtcttcccctccatcgtggggcgccccaggcac cagggcgtgatggtgggcatgggtcagaaggattcatatgtgggcgacgaggcccaaagc aagagaggcattctcaccctgaagtaccccatcgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaatgagctgcgtgtggctcctgaggag caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgacc cagatcatgtttgagactttcaacaccccagccatgtacgtggccatccaggctgtgctg tccctgtacgcctctggccgtaccactggcatcgtgatggactccggtgacggggtcacc cacactgtgcccatctacgaggggtatgccctcccccatgccatcctgcgtctggacctg gctggccgggacctgactgactacctcatgaagatcctcactgagcgcggctacagcttc accaccacggccgagcgggaaatcgtgcgtgacattaaggagaagctgtgctatgtcgcc ctggacttcgagcaggagatggccacggcggcttccagctcctccctggagaagagctac gagctgcccgatggccaggtcatcaccattggcaacgagcggttccgctgccctgaggct ctcttccaaccttccttcctgggcatggagtcctgtggcatccacgaaactaccttcaac tccatcatgaagtgtgacgtggacatccgtaaagacctgtacgccaacacagtgctgtct ggtggcaccaccatgtaccctggcattgctgacaggatgcagaaggagattactgccctg gcgcccagcacgatgaagatcaagatcattgctcctcctgagcgcaagtactctgtgtgg atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtctggcccttccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system