Theropithecus gelada (gelada): 112621592 Help Entry 112621592         CDS       T08041                                  Symbol IL6 Name (RefSeq) interleukin-6 isoform X1   KO K05405   interleukin 6 Organism tge  Theropithecus gelada (gelada) Pathway tge01521   EGFR tyrosine kinase inhibitor resistance tge01523   Antifolate resistance tge04060   Cytokine-cytokine receptor interaction tge04061   Viral protein interaction with cytokine and cytokine receptor tge04066   HIF-1 signaling pathway tge04068   FoxO signaling pathway tge04151   PI3K-Akt signaling pathway tge04218   Cellular senescence tge04620   Toll-like receptor signaling pathway tge04621   NOD-like receptor signaling pathway tge04623   Cytosolic DNA-sensing pathway tge04625   C-type lectin receptor signaling pathway tge04630   JAK-STAT signaling pathway tge04640   Hematopoietic cell lineage tge04657   IL-17 signaling pathway tge04659   Th17 cell differentiation tge04668   TNF signaling pathway tge04672   Intestinal immune network for IgA production tge04931   Insulin resistance tge04932   Non-alcoholic fatty liver disease tge04933   AGE-RAGE signaling pathway in diabetic complications tge04936   Alcoholic liver disease tge05010   Alzheimer disease tge05020   Prion disease tge05022   Pathways of neurodegeneration - multiple diseases tge05132   Salmonella infection tge05133   Pertussis tge05134   Legionellosis tge05135   Yersinia infection tge05142   Chagas disease tge05143   African trypanosomiasis tge05144   Malaria tge05146   Amoebiasis tge05152   Tuberculosis tge05161   Hepatitis B tge05162   Measles tge05163   Human cytomegalovirus infection tge05164   Influenza A tge05166   Human T-cell leukemia virus 1 infection tge05167   Kaposi sarcoma-associated herpesvirus infection tge05168   Herpes simplex virus 1 infection tge05169   Epstein-Barr virus infection tge05171   Coronavirus disease - COVID-19 tge05200   Pathways in cancer tge05202   Transcriptional misregulation in cancer tge05321   Inflammatory bowel disease tge05323   Rheumatoid arthritis tge05332   Graft-versus-host disease tge05410   Hypertrophic cardiomyopathy tge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112621592 (IL6)    04668 TNF signaling pathway     112621592 (IL6)    04066 HIF-1 signaling pathway     112621592 (IL6)    04068 FoxO signaling pathway     112621592 (IL6)    04151 PI3K-Akt signaling pathway     112621592 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112621592 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     112621592 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     112621592 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     112621592 (IL6)    04620 Toll-like receptor signaling pathway     112621592 (IL6)    04621 NOD-like receptor signaling pathway     112621592 (IL6)    04623 Cytosolic DNA-sensing pathway     112621592 (IL6)    04625 C-type lectin receptor signaling pathway     112621592 (IL6)    04659 Th17 cell differentiation     112621592 (IL6)    04657 IL-17 signaling pathway     112621592 (IL6)    04672 Intestinal immune network for IgA production     112621592 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112621592 (IL6)    05202 Transcriptional misregulation in cancer     112621592 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112621592 (IL6)    05161 Hepatitis B     112621592 (IL6)    05171 Coronavirus disease - COVID-19     112621592 (IL6)    05164 Influenza A     112621592 (IL6)    05162 Measles     112621592 (IL6)    05168 Herpes simplex virus 1 infection     112621592 (IL6)    05163 Human cytomegalovirus infection     112621592 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     112621592 (IL6)    05169 Epstein-Barr virus infection     112621592 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     112621592 (IL6)    05135 Yersinia infection     112621592 (IL6)    05133 Pertussis     112621592 (IL6)    05134 Legionellosis     112621592 (IL6)    05152 Tuberculosis     112621592 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     112621592 (IL6)    05144 Malaria     112621592 (IL6)    05142 Chagas disease     112621592 (IL6)    05143 African trypanosomiasis     112621592 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     112621592 (IL6)    05321 Inflammatory bowel disease     112621592 (IL6)    05332 Graft-versus-host disease     112621592 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     112621592 (IL6)    05020 Prion disease     112621592 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     112621592 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112621592 (IL6)    05410 Hypertrophic cardiomyopathy     112621592 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112621592 (IL6)    04932 Non-alcoholic fatty liver disease     112621592 (IL6)    04931 Insulin resistance     112621592 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     112621592 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     112621592 (IL6)    01523 Antifolate resistance     112621592 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112621592 (IL6) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Interleukins    112621592 (IL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL11 IL23 Phage_int_SAM_1 GCSF Motif Other DBs NCBI-GeneID:  112621592 NCBI-ProteinID:  XP_025236833 Ensembl:  ENSTGEG00000022509 LinkDB All DBs Position 3:complement(90109202..90114066) Genome browser AA seq 266 aa AA seqDB search MNSVSTSKCRKSLALERPAAVEPCVREGCVAQGGLAGGQQQRQAPSCAVSSPRRSLPSGT GAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKDVAAPHSQPLTSSERIDKQIRYILDGISA LRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLLEFEVYL EYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQAQNQWL QDMTTHLILRSFKEFLQSSLRALRQM NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atgaactccgtctccacaagtaagtgcaggaaatccctagccctggaacggccagcggcg gtcgagccctgtgtgagggaggggtgtgtggcccagggagggctggcgggcggccagcag cagaggcaggctcccagctgtgctgtcagctcaccccgccgctcgctcccctccggcaca ggcgccttcggtccagttgctttctccctggggctgctcctggtgttgcctgctgccttc cccgccccagtactcccaggagaagattccaaagatgtagccgccccacacagccagcca ctgacctcttcagaacgaattgacaaacaaattcggtacatcctcgacggcatctcagcc ctgagaaaggagacatgtaacaggagtaacatgtgtgaaagcagcaaagaggcactggca gaaaacaacctgaaccttccaaagatggctgaaaaagatggatgcttccaatctggattc aatgaggacacttgcctggtgaaaatcatcactggtcttttggagtttgaggtataccta gagtacctccagaacaggtttgagagtagtgaggagcaagccagagctgtgcaaatgagt acaaaagtcctgatccagttcctgcagaaaaaggcaaagaatctagatgcaataaccacc cctgaaccaaccacaaatgccagcctgctgacgaagctgcaggcacagaaccagtggctg caggacatgacgacgcatctcatcctgcgcagctttaaggagttcctgcagtccagcctg agggctcttcggcaaatgtaa

DBGET integrated database retrieval system