Theropithecus gelada (gelada): 112628931 Help Entry 112628931         CDS       T08041                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism tge  Theropithecus gelada (gelada) Pathway tge03083   Polycomb repressive complex tge04010   MAPK signaling pathway tge05200   Pathways in cancer tge05202   Transcriptional misregulation in cancer tge05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:tge00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     112628931 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112628931 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112628931 (MAX)    05202 Transcriptional misregulation in cancer     112628931 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     112628931 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:tge03000]     112628931 (MAX)    03036 Chromosome and associated proteins [BR:tge03036]     112628931 (MAX) Transcription factors [BR:tge03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     112628931 (MAX) Chromosome and associated proteins [BR:tge03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      112628931 (MAX) SSDB OrthologParalogGFIT Motif Pfam:  HLH CEP135_TSGA10_CC bHLH_IRO3 bZIP_2 JetA Filament TPR T4SS_LegC2C7 YEL043W_helical bHLH_INO4 SlyX Tp0624_N PUMA_CC bHLH_SAC51 ANG-1 MYCBP_helical DUF7801 GAGA_bind SLX9 DUF4763 Csm1_N Motif Other DBs NCBI-GeneID:  112628931 NCBI-ProteinID:  XP_025248049 Ensembl:  ENSTGEG00000017667 UniProt:  A0A8D2FJC9 LinkDB All DBs Position 7b:complement(66300483..66397640) Genome browser AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgacgacctcaagcggcagaatgctcttctggagcagcaagtccgt gcactggagaaggcgaggtcaagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc agctcggagtctgagcctgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system