Theropithecus gelada (gelada): 112634767 Help Entry 112634767         CDS       T08041                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism tge  Theropithecus gelada (gelada) Pathway tge03050   Proteasome tge04060   Cytokine-cytokine receptor interaction tge04066   HIF-1 signaling pathway tge04217   Necroptosis tge04350   TGF-beta signaling pathway tge04380   Osteoclast differentiation tge04612   Antigen processing and presentation tge04630   JAK-STAT signaling pathway tge04650   Natural killer cell mediated cytotoxicity tge04657   IL-17 signaling pathway tge04658   Th1 and Th2 cell differentiation tge04659   Th17 cell differentiation tge04660   T cell receptor signaling pathway tge04940   Type I diabetes mellitus tge05140   Leishmaniasis tge05142   Chagas disease tge05143   African trypanosomiasis tge05144   Malaria tge05145   Toxoplasmosis tge05146   Amoebiasis tge05152   Tuberculosis tge05160   Hepatitis C tge05164   Influenza A tge05168   Herpes simplex virus 1 infection tge05200   Pathways in cancer tge05235   PD-L1 expression and PD-1 checkpoint pathway in cancer tge05321   Inflammatory bowel disease tge05322   Systemic lupus erythematosus tge05323   Rheumatoid arthritis tge05330   Allograft rejection tge05332   Graft-versus-host disease tge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tge00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     112634767 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     112634767 (IFNG)    04630 JAK-STAT signaling pathway     112634767 (IFNG)    04066 HIF-1 signaling pathway     112634767 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112634767 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112634767 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     112634767 (IFNG)    04612 Antigen processing and presentation     112634767 (IFNG)    04660 T cell receptor signaling pathway     112634767 (IFNG)    04658 Th1 and Th2 cell differentiation     112634767 (IFNG)    04659 Th17 cell differentiation     112634767 (IFNG)    04657 IL-17 signaling pathway     112634767 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     112634767 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112634767 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112634767 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     112634767 (IFNG)    05164 Influenza A     112634767 (IFNG)    05168 Herpes simplex virus 1 infection     112634767 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     112634767 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     112634767 (IFNG)    05144 Malaria     112634767 (IFNG)    05145 Toxoplasmosis     112634767 (IFNG)    05140 Leishmaniasis     112634767 (IFNG)    05142 Chagas disease     112634767 (IFNG)    05143 African trypanosomiasis     112634767 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     112634767 (IFNG)    05323 Rheumatoid arthritis     112634767 (IFNG)    05321 Inflammatory bowel disease     112634767 (IFNG)    05330 Allograft rejection     112634767 (IFNG)    05332 Graft-versus-host disease     112634767 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112634767 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112634767 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:tge03051]     112634767 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112634767 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:tge00536]     112634767 (IFNG) Proteasome [BR:tge03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     112634767 (IFNG) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Interferons    112634767 (IFNG) Glycosaminoglycan binding proteins [BR:tge00536]  Heparan sulfate / Heparin   Cytokines    112634767 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma NolX Tup_N Motif Other DBs NCBI-GeneID:  112634767 NCBI-ProteinID:  XP_025258359 Ensembl:  ENSTGEG00000021804 UniProt:  A0A8D2K6D9 LinkDB All DBs Position 11:complement(27153602..27158526) Genome browser AA seq 165 aa AA seqDB search MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWK EESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAVHELIQVMAELSPAAKIGKRKRSQTFRGRRASQ NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgaaatatacaagttatatcttggcttttcagctctgcattgttttgggttctcttggc tgttactgccaggacccgtatgtaaaagaagcagaaaaccttaagaaatattttaatgca ggtgatccagatgtagcagataatggaactcttttcttagacatcttgaggaattggaaa gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt aaaaacttcaaagatgaccagaggatccaaaagagtgtggagaccatcaaggaagacatt aatgtcaagtttttcaatagcaacaaaaagaaacgggatgacttcgaaaagctgaccaat tattcggtaactgacttgaacgtccaacgcaaagcagtacatgaactcatccaagtgatg gctgaactgtcgcctgcagctaaaatagggaagcgaaaaaggagtcagacgtttcgaggt cgaagagcatcccaataa

DBGET integrated database retrieval system