Theropithecus gelada (gelada): 112636140 Help Entry 112636140         CDS       T08041                                  Symbol IL10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism tge  Theropithecus gelada (gelada) Pathway tge04060   Cytokine-cytokine receptor interaction tge04061   Viral protein interaction with cytokine and cytokine receptor tge04068   FoxO signaling pathway tge04148   Efferocytosis tge04625   C-type lectin receptor signaling pathway tge04630   JAK-STAT signaling pathway tge04660   T cell receptor signaling pathway tge04672   Intestinal immune network for IgA production tge05133   Pertussis tge05135   Yersinia infection tge05140   Leishmaniasis tge05142   Chagas disease tge05143   African trypanosomiasis tge05144   Malaria tge05145   Toxoplasmosis tge05146   Amoebiasis tge05150   Staphylococcus aureus infection tge05152   Tuberculosis tge05310   Asthma tge05320   Autoimmune thyroid disease tge05321   Inflammatory bowel disease tge05322   Systemic lupus erythematosus tge05330   Allograft rejection Brite KEGG Orthology (KO) [BR:tge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112636140 (IL10)    04068 FoxO signaling pathway     112636140 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112636140 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     112636140 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     112636140 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112636140 (IL10)    04660 T cell receptor signaling pathway     112636140 (IL10)    04672 Intestinal immune network for IgA production     112636140 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     112636140 (IL10)    05133 Pertussis     112636140 (IL10)    05150 Staphylococcus aureus infection     112636140 (IL10)    05152 Tuberculosis     112636140 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     112636140 (IL10)    05144 Malaria     112636140 (IL10)    05145 Toxoplasmosis     112636140 (IL10)    05140 Leishmaniasis     112636140 (IL10)    05142 Chagas disease     112636140 (IL10)    05143 African trypanosomiasis     112636140 (IL10)   09163 Immune disease    05310 Asthma     112636140 (IL10)    05322 Systemic lupus erythematosus     112636140 (IL10)    05320 Autoimmune thyroid disease     112636140 (IL10)    05321 Inflammatory bowel disease     112636140 (IL10)    05330 Allograft rejection     112636140 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tge04052]     112636140 (IL10)    00536 Glycosaminoglycan binding proteins [BR:tge00536]     112636140 (IL10) Cytokines and neuropeptides [BR:tge04052]  Cytokines   Interleukins    112636140 (IL10) Glycosaminoglycan binding proteins [BR:tge00536]  Heparan sulfate / Heparin   Cytokines    112636140 (IL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 IL22 ALIX_LYPXL_bnd CLZ Motif Other DBs NCBI-GeneID:  112636140 NCBI-ProteinID:  XP_025260416 Ensembl:  ENSTGEG00000012362 UniProt:  A0A8D2F704 LinkDB All DBs Position 1:158865817..158870779 Genome browser AA seq 178 aa AA seqDB search MHSSALLCCLVLLTGVRASPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQ LDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLR LRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcacagctcagcactgctctgttgcctagtcctcctgactggggtgagggccagccca ggccagggcacccagtctgagaacagctgcacccgcttcccaggcaacctgcctcacatg cttcgagacctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag ctggacaacatattgttaaaggagtccttgctggaggactttaagggttacctgggttgc caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac cacgacccagacatcaaggagcatgtgaactccctgggggagaatctgaagaccctcagg ctgaggctgcggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggccgtggag caggtgaagaatgcctttagtaagctccaagagaaaggcgtctacaaagccatgagtgag tttgacatcttcatcaactacatagaagcctacatgacaatgaagatacaaaactga

DBGET integrated database retrieval system