Thalassovita gelatinovora: HFZ77_17610 Help Entry HFZ77_17610       CDS       T06533                                  Name (GenBank) hypothetical protein   KO K00286   pyrroline-5-carboxylate reductase [EC:1.5.1.2] Organism tgl  Thalassovita gelatinovora Pathway tgl00330   Arginine and proline metabolism tgl01100   Metabolic pathways tgl01110   Biosynthesis of secondary metabolites tgl01230   Biosynthesis of amino acids Module tgl_M00015   Proline biosynthesis, glutamate => proline Brite KEGG Orthology (KO) [BR:tgl00001]  09100 Metabolism   09105 Amino acid metabolism    00330 Arginine and proline metabolism     HFZ77_17610 Enzymes [BR:tgl01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.2  pyrroline-5-carboxylate reductase      HFZ77_17610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  P5CR_dimer Motif Other DBs NCBI-ProteinID:  QIZ82162 LinkDB All DBs Position complement(3608204..3608368) Genome browser AA seq 54 aa AA seqDB search MLKENRTPSVLRESVSSKGGTTAAALDTFAENDALQIAVENAVNAAAARSRALG NT seq 165 nt NT seq  +upstreamnt  +downstreamnt ttgctgaaagaaaacagaactccatctgtactgcgagaaagcgtgagctcaaaagggggt actacagcagccgcattggatacctttgccgaaaacgacgccctgcagatagccgtggag aacgcggtgaatgcggccgcggcgcgatcacgcgcgcttgggtga

DBGET integrated database retrieval system