Taeniopygia guttata (zebra finch): 100190092 Help Entry 100190092         CDS       T01082                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu03420   Nucleotide excision repair tgu04110   Cell cycle tgu04114   Oocyte meiosis tgu04120   Ubiquitin mediated proteolysis tgu04141   Protein processing in endoplasmic reticulum tgu04310   Wnt signaling pathway tgu04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:tgu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100190092 (RBX1)    04120 Ubiquitin mediated proteolysis     100190092 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     100190092 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100190092 (RBX1)    04350 TGF-beta signaling pathway     100190092 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tgu04121]     100190092 (RBX1)    03400 DNA repair and recombination proteins [BR:tgu03400]     100190092 (RBX1) Enzymes [BR:tgu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      100190092 (RBX1) Ubiquitin system [BR:tgu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    100190092 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      100190092 (RBX1)    Cul2 complex      100190092 (RBX1)    Cul3 complex      100190092 (RBX1)    Cul4 complex      100190092 (RBX1)    Cul7 complex      100190092 (RBX1)    Cul8 complex      100190092 (RBX1)    Cul9 complex      100190092 (RBX1) DNA repair and recombination proteins [BR:tgu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       100190092 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       100190092 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 zf-RING_UBOX PHD_NSD Motif Other DBs NCBI-GeneID:  100190092 NCBI-ProteinID:  NP_001232445 Ensembl:  ENSTGUG00000010035 UniProt:  B5FY05 LinkDB All DBs Position 1A:complement(47740039..47750870) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVALGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcaatggatgtggacactcccagcggaaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaacgccgtagctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccacattatggatctgtgcatagaatgtcaagccaaccaa gcatcggctacctctgaggaatgcacagttgcattgggcgtctgcaatcacgctttccac ttccactgcatctctcgctggctcaaaacacgccaagtatgtccactggacaacagggaa tgggagttccaaaagtatggacactag

DBGET integrated database retrieval system