Taeniopygia guttata (zebra finch): 100190162 Help Entry 100190162         CDS       T01082                                  Symbol RAN Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu03008   Ribosome biogenesis in eukaryotes tgu03013   Nucleocytoplasmic transport tgu03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:tgu00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     100190162 (RAN)    03008 Ribosome biogenesis in eukaryotes     100190162 (RAN)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     100190162 (RAN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tgu03019]     100190162 (RAN)    03009 Ribosome biogenesis [BR:tgu03009]     100190162 (RAN)    03016 Transfer RNA biogenesis [BR:tgu03016]     100190162 (RAN)    03036 Chromosome and associated proteins [BR:tgu03036]     100190162 (RAN)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tgu04147]     100190162 (RAN)    04031 GTP-binding proteins [BR:tgu04031]     100190162 (RAN) Messenger RNA biogenesis [BR:tgu03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      100190162 (RAN) Ribosome biogenesis [BR:tgu03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     100190162 (RAN)   Pre-60S particles     100190162 (RAN) Transfer RNA biogenesis [BR:tgu03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     100190162 (RAN) Chromosome and associated proteins [BR:tgu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      100190162 (RAN)    Spindle formation proteins     100190162 (RAN) Exosome [BR:tgu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100190162 (RAN) GTP-binding proteins [BR:tgu04031]  Small (monomeric) G-proteins   Ran Family    Ran     100190162 (RAN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU G-alpha Gtr1_RagA RNA_helicase Pox_A32 AAA_24 ArgoMid Septin AAA_7 TsaE AAA_16 SRPRB DUF5906 AAA_22 Motif Other DBs NCBI-GeneID:  100190162 NCBI-ProteinID:  NP_001232636 UniProt:  B5FYI3 LinkDB All DBs Position 15:13303487..13307714 Genome browser AA seq 216 aa AA seqDB search MAAQGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIK FNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLC GNKVDIKDRKVKAKPIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMP ALAPPEVVMDPALAAQYEQDLQIAQTTALPDEDDDL NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggccgcccagggagagccgcaagtgcagtttaagcttgttctggttggtgatggtggc actggtaaaacaacatttgtaaagcgtcacttgactggtgaatttgaaaagaagtatgta gccacactgggtgttgaagttcatcctctggtgttccatactaacagaggccctattaaa tttaatgtatgggacacagctggccaggagaagtttggtggcctgcgtgatggctactat atccaagctcagtgtgccatcatcatgtttgatgtaacatcaagagttacttacaagaat gtacctaattggcatagagatctggtacgagtatgtgaaaatatccccatagtcttgtgt ggcaacaaagtggatattaaggacagaaaagtcaaggcaaaacccattgtgttccatagg aagaagaatctccagtattatgacatttcagctaagagtaactacaactttgagaagcct ttcctgtggcttgctaggaagctcattggagatcccaacttggagtttgttgccatgcct gcgcttgcacctcctgaagttgttatggacccagcactggcagcacagtatgagcaagac ttacagattgctcagaccaccgcactgccagatgaagatgatgacctgtga

DBGET integrated database retrieval system