Taeniopygia guttata (zebra finch): 100224711 Help Entry 100224711         CDS       T01082                                  Symbol PLA2G1B Name (RefSeq) phospholipase A2 isoform X1   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu00564   Glycerophospholipid metabolism tgu00565   Ether lipid metabolism tgu00590   Arachidonic acid metabolism tgu00591   Linoleic acid metabolism tgu00592   alpha-Linolenic acid metabolism tgu01100   Metabolic pathways tgu04270   Vascular smooth muscle contraction Brite KEGG Orthology (KO) [BR:tgu00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     100224711 (PLA2G1B)    00565 Ether lipid metabolism     100224711 (PLA2G1B)    00590 Arachidonic acid metabolism     100224711 (PLA2G1B)    00591 Linoleic acid metabolism     100224711 (PLA2G1B)    00592 alpha-Linolenic acid metabolism     100224711 (PLA2G1B)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     100224711 (PLA2G1B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tgu03036]     100224711 (PLA2G1B) Enzymes [BR:tgu01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      100224711 (PLA2G1B) Chromosome and associated proteins [BR:tgu03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     100224711 (PLA2G1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_4 Motif Other DBs NCBI-GeneID:  100224711 NCBI-ProteinID:  XP_002199575 Ensembl:  ENSTGUG00000009518 LinkDB All DBs Position 15:3507438..3511246 Genome browser AA seq 147 aa AA seqDB search MKFLALLFLLSVGTASAEVSPRAVWLFREMIKCTLPKSHPLLEFNHYGCYCGLGGSGTPV DELDRCCQAHDNCYTQAKKMESCKFLLDNPYTKLYHFSCSDKQITCSSENNECATFICNC DRTAAMCFAKAPYNPEHKHLDTDKYCK NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgaagttcctggccctgcttttcctgctgtcagtgggcacagccagcgccgaggtctcg ccccgggccgtgtggctgttccgcgaaatgatcaagtgcaccctgcccaaaagccaccca ctgctggaattcaaccactacggctgctactgtggcctggggggcagcggcactccagtg gacgagcttgacaggtgctgccaagcacatgataactgctacacacaggcaaagaaaatg gaatcctgcaaattcctcctggacaacccctacactaagctgtaccacttcagctgctct gataagcagatcacgtgtagcagtgagaacaacgagtgcgccacgttcatatgcaactgc gaccggactgctgccatgtgcttcgccaaggcgccctacaaccccgagcacaagcaccta gacaccgacaaatactgcaaataa

DBGET integrated database retrieval system