Thalassotalea sp. LPB0316: LP316_04870 Help Entry LP316_04870       CDS       T08426                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism thab  Thalassotalea sp. LPB0316 Pathway thab00670   One carbon pool by folate thab00790   Folate biosynthesis thab01100   Metabolic pathways thab01240   Biosynthesis of cofactors thab04981   Folate transport and metabolism Module thab_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:thab00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LP316_04870 (folA)    00670 One carbon pool by folate     LP316_04870 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     LP316_04870 (folA) Enzymes [BR:thab01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      LP316_04870 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 ParM_N DUF6892 Motif Other DBs NCBI-ProteinID:  QOL26637 UniProt:  A0A7L9S8I2 LinkDB All DBs Position 1092420..1092911 Genome browser AA seq 163 aa AA seqDB search MTTLSMIVAHADNRIIGKDNDMPWHLPADLAYFKKTTLGKPVIMGRKTYDSIGRALPGRQ NIVISRDPTLTINGVDVVQSVDQALALASGVEEIMVIGGGAIYQHCMPKADKLYITHIDA NIDGDTQFPEYDLVNDWQLLSSETRQPDEKNAYMLRFNVYQRR NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atgacgacattatcaatgattgttgcccatgctgataatcgcattattggtaaagataac gatatgccttggcatttgccggccgatttagcctactttaagaaaacgacactgggcaaa cccgtgatcatgggcagaaaaacctatgattccattgggcgcgcactacctgggcggcaa aacattgttatttcccgtgatcctacgctaaccataaacggtgtggatgttgtacaaagt gtagatcaagcgctcgcgttggctagtggtgttgaagaaattatggtgatcggtggtggc gcaatttatcagcactgcatgcctaaagcagacaaattatacatcactcatattgacgcc aacattgatggtgatacccagtttcccgagtacgatttagtcaacgattggcagctacta agctctgaaacacgacagccagatgaaaagaacgcgtatatgcttcgatttaatgtttat cagcgtcgctga

DBGET integrated database retrieval system