KEGG   Thermodesulfomicrobium sp. WS: TDMWS_08460
Entry
TDMWS_08460       CDS       T08730                                 
Symbol
fabG
Name
(GenBank) beta-ketoacyl-ACP reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
thew  Thermodesulfomicrobium sp. WS
Pathway
thew00061  Fatty acid biosynthesis
thew00780  Biotin metabolism
thew01100  Metabolic pathways
thew01110  Biosynthesis of secondary metabolites
thew01212  Fatty acid metabolism
thew01240  Biosynthesis of cofactors
Module
thew_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:thew00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TDMWS_08460 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    TDMWS_08460 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    TDMWS_08460 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:thew01004]
    TDMWS_08460 (fabG)
Enzymes [BR:thew01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     TDMWS_08460 (fabG)
Lipid biosynthesis proteins [BR:thew01004]
 Fatty acid synthase
  Component type
   TDMWS_08460 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR Epimerase NAD_binding_10 GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: BDV00761
LinkDB
Position
complement(905956..906693)
AA seq 245 aa
MSDSIRTALVTGGTRGIGKAIVTTLAERGYHVYFTYVSRPELAEELCASLSPAPVRGFRV
DAGDPAAIAQFFAEEIKDKVFLAALINNAGITRDGLLVRMKLAAWEEVLRVNLTGAFVFL
QEAAKIMMRQRFGRIVSIASVVGQMGNAGQANYCAAKAGLIGLTKSAALELAPRGITVNA
VAPGFIETDMTGGLSQEIRDAYQARIPLGRLGSAQDVAEATAFLLSDAAAYITGQVIGVN
GGMYL
NT seq 738 nt   +upstreamnt  +downstreamnt
atgagcgattccatccgcaccgcgctggtcaccggcggcacccgcggcattggcaaggcc
attgtcaccaccctggccgagcgcggctatcacgtgtacttcacctacgtgagccggcca
gaactggcagaggagctctgtgcctccctgagcccagccccagtgcgcggctttcgcgtg
gacgccggggacccggcggccattgcccaattcttcgcggaagaaatcaaagacaaggtc
tttctcgcggcgctcatcaacaatgccggcatcacccgagacggccttttggtgcgcatg
aagcttgccgcctgggaagaggtcctgcgcgtgaacctcaccggggccttcgtcttcctt
caggaagcggccaagatcatgatgcgccagcgctttggccgcatcgtctccatcgcctcg
gtcgtggggcagatgggcaatgccggccaggccaactactgcgccgccaaggcgggcctc
atcgggctcaccaaatccgcggccctggagcttgccccgcgcggcatcacggtcaacgcc
gtggctccgggcttcatcgaaaccgacatgaccggcgggctctcccaggagatccgcgac
gcctaccaggcgcgcatccccttgggccgtctcgggtctgcacaggacgtggccgaggcc
acggccttcctactctcggacgcggccgcatacatcaccggtcaagtcattggcgtcaac
ggcgggatgtatctctag

DBGET integrated database retrieval system