Tarenaya hassleriana (spider flower): 104811002 Help Entry 104811002         CDS       T04125                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism thj  Tarenaya hassleriana (spider flower) Pathway thj03420   Nucleotide excision repair thj04120   Ubiquitin mediated proteolysis thj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:thj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104811002    04120 Ubiquitin mediated proteolysis     104811002   09124 Replication and repair    03420 Nucleotide excision repair     104811002  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:thj04121]     104811002    03400 DNA repair and recombination proteins [BR:thj03400]     104811002 Enzymes [BR:thj01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104811002 Ubiquitin system [BR:thj04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104811002   Multi subunit type E3    SCF complex     Ring finger protein      104811002    Cul2 complex      104811002    Cul3 complex      104811002    Cul4 complex      104811002    Cul7 complex      104811002    Cul8 complex      104811002    Cul9 complex      104811002 DNA repair and recombination proteins [BR:thj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104811002     TCR (transcription coupled repair) factors      Cul4-CSA complex       104811002 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  104811002 NCBI-ProteinID:  XP_010535818 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MASLDSGVTMAPAGEGSSSAAPSSSTKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcgtctctggattccggtgttaccatggctcccgccggggaaggctccagcagcgcc gctccttcctcttccacgaagaagccgaagcgctttgagattaaaaagtggagtgccgtc gcgctctgggcttgggatatcgttgttgacaactgcgcaatctgccggaaccacatcatg gatctatgcattgaatgccaggctaatcaggccagtgccaccagcgaggaatgcaccgtt gcttggggggtttgcaaccatgcctttcacttccactgcatcagccgatggctcaagact cgtcaagtatgtccattggataacagcgagtgggaatttcagaaatacggccactga

DBGET integrated database retrieval system