Tarenaya hassleriana (spider flower): 104815338 Help Entry 104815338         CDS       T04125                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism thj  Tarenaya hassleriana (spider flower) Pathway thj03420   Nucleotide excision repair thj04120   Ubiquitin mediated proteolysis thj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:thj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104815338    04120 Ubiquitin mediated proteolysis     104815338   09124 Replication and repair    03420 Nucleotide excision repair     104815338  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:thj04121]     104815338    03400 DNA repair and recombination proteins [BR:thj03400]     104815338 Enzymes [BR:thj01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104815338 Ubiquitin system [BR:thj04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104815338   Multi subunit type E3    SCF complex     Ring finger protein      104815338    Cul2 complex      104815338    Cul3 complex      104815338    Cul4 complex      104815338    Cul7 complex      104815338    Cul8 complex      104815338    Cul9 complex      104815338 DNA repair and recombination proteins [BR:thj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104815338     TCR (transcription coupled repair) factors      Cul4-CSA complex       104815338 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  104815338 NCBI-ProteinID:  XP_010541993 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDSDITMVPAGEGSTAAASSLPSSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggattccgatattacgatggttcccgctggcgaaggctctaccgccgccgcttcctcc ttgccgtcttcttccaccaagaaaccgaaacgattcgagatcaaaaagtggaacgccgtc gccctctgggcctgggatatcgtcgtggataactgcgcgatctgcaggaatcatatcatg gatctatgcatcgagtgccaggcgaatcaggcaagcgcaacgagtgaagaatgtactgtt gcttggggggtttgcaatcatgcttttcattttcactgcatcagccgttggctcaagact cgtcaagtttgccccttggataacagcgagtgggagtttcagaagtatgggcattaa

DBGET integrated database retrieval system