Tarenaya hassleriana (spider flower): 104826593 Help Entry 104826593         CDS       T04125                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism thj  Tarenaya hassleriana (spider flower) Pathway thj03420   Nucleotide excision repair thj04120   Ubiquitin mediated proteolysis thj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:thj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104826593    04120 Ubiquitin mediated proteolysis     104826593   09124 Replication and repair    03420 Nucleotide excision repair     104826593  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:thj04121]     104826593    03400 DNA repair and recombination proteins [BR:thj03400]     104826593 Enzymes [BR:thj01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104826593 Ubiquitin system [BR:thj04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104826593   Multi subunit type E3    SCF complex     Ring finger protein      104826593    Cul2 complex      104826593    Cul3 complex      104826593    Cul4 complex      104826593    Cul7 complex      104826593    Cul8 complex      104826593    Cul9 complex      104826593 DNA repair and recombination proteins [BR:thj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104826593     TCR (transcription coupled repair) factors      Cul4-CSA complex       104826593 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  104826593 NCBI-ProteinID:  XP_010557667 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search MATMDSDVPMVPAGEDSNTASASLPSSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRN HIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYG H NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcgacgatggattctgatgtcccgatggtacccgccggagaagactcaaatactgcc tccgcttccttgccgtcttcttcaaccaagaaacccaaaagattcgagatcaagaagtgg aacgccgtcgccctctgggcctgggatatcgtcgtggataactgtgcgatctgcaggaat catatcatggatctatgcatcgagtgccaggcgaatcaggcaagcgcgacgagtgaagag tgtactgttgcttggggggtttgcaaccatgcttttcattttcactgcattagccgttgg ctcaagacccgtcaagtttgccccttggataacagtgagtgggagtttcagaagtacggg cattag

DBGET integrated database retrieval system