KEGG   Thermococcus paralvinellae: TES1_0505
Entry
TES1_0505         CDS       T03005                                 

Definition
(GenBank) 3-isopropylmalate dehydrogenase
  KO
K17753  isocitrate--homoisocitrate dehydrogenase [EC:1.1.1.286]
Organism
ths  Thermococcus paralvinellae
Pathway
ths00020  Citrate cycle (TCA cycle)
ths00300  Lysine biosynthesis
ths01100  Metabolic pathways
ths01110  Biosynthesis of secondary metabolites
ths01120  Microbial metabolism in diverse environments
ths01210  2-Oxocarboxylic acid metabolism
ths01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ths00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TES1_0505
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    TES1_0505
Enzymes [BR:ths01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.286  isocitrate---homoisocitrate dehydrogenase
     TES1_0505
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-ProteinID: AHF79899
UniProt: W0I1K8
LinkDB
Position
471394..472437
AA seq 347 aa
MYRVAVIKGDGIGIEVTEAAIEVINAVTDRIEFIEFEGGFEVFKRYGAPIREEDLEEIKK
MDAVLFGATSTPFDVPNYKSLIITLRKELNLYANLRIIPDLWNEREIYIVRENSEGLYSG
LYDVEKEKVVDYRIITRKGAERIARFAINLAKEKREKVTFVHKANVLMGDKFFRKVVLSL
AEREGVEVREKIVDSFTIELVRNPWNQEIILTENLFGDILSDLAAIHARSIGIVPSGNYG
DDIALFEPIHGTAPDIAGKGIANPIGSILSGAMLLDYLNLNGQIIWEAVKSYVRKGNLTP
DLGGTAMTKDVVEGIIEEIEYRIDPLEWDEVWVDEIRINFIPTLFIK
NT seq 1044 nt   +upstreamnt  +downstreamnt
gtgtatagagtagcggtcattaagggagacggcattggcattgaagttacagaagctgca
attgaagttataaacgcggtaactgatagaatagagtttattgagtttgaaggtggcttc
gaggtattcaaaagatatggggccccaataagagaggaggacttggaagagataaagaaa
atggatgcagttttatttggggcaacatcaacacctttcgacgttccaaattacaaaagc
ttaatcataacgcttagaaaggaacttaacctttatgctaacctaagaataatccccgat
ttgtggaatgagagagaaatctatattgttagggaaaacagcgaaggcctttattctggg
ctttacgatgttgaaaaagagaaagttgttgattacaggataataacaagaaaaggagct
gaaagaatagcaagattcgccataaatttggcaaaagaaaaaagggaaaaggttactttc
gtccataaagcaaatgtcctaatgggtgacaagttctttaggaaagtcgtcttgagttta
gccgaaagggaaggagtcgaggttagagaaaaaattgtagattccttcacaatagaactc
gtcaggaatccatggaatcaggagattattttaacggaaaacctctttggtgacattctt
tcggacttagcagctattcacgcaaggagtattgggattgttccctctggaaactatggt
gatgatatagccctatttgaacctattcacggaactgcacctgatatagctggaaagggg
atagccaatccaattgggtctattttgagcggtgccatgcttttggattatctcaactta
aacggtcaaatcatctgggaagctgtcaaatcctacgtgaggaaaggcaacctaacgccc
gatttggggggaactgcaatgacgaaggatgttgttgaaggaattatcgaggagatagaa
tatcgaattgaccccttggagtgggacgaagtttgggttgatgaaattaggatcaacttc
atcccaacacttttcataaagtaa

DBGET integrated database retrieval system