Tuber melanosporum: GSTUM_00002417001 Help Entry GSTUM_00002417001 CDS       T01282                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tml  Tuber melanosporum Pathway tml03420   Nucleotide excision repair tml04111   Cell cycle - yeast tml04120   Ubiquitin mediated proteolysis tml04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tml00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     GSTUM_00002417001    04120 Ubiquitin mediated proteolysis     GSTUM_00002417001   09124 Replication and repair    03420 Nucleotide excision repair     GSTUM_00002417001  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     GSTUM_00002417001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tml04121]     GSTUM_00002417001    03400 DNA repair and recombination proteins [BR:tml03400]     GSTUM_00002417001 Enzymes [BR:tml01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      GSTUM_00002417001 Ubiquitin system [BR:tml04121]  Ubiquitin ligases (E3)   UBL E3 ligases    GSTUM_00002417001   Multi subunit type E3    SCF complex     Ring finger protein      GSTUM_00002417001    Cul2 complex      GSTUM_00002417001    Cul3 complex      GSTUM_00002417001    Cul4 complex      GSTUM_00002417001    Cul7 complex      GSTUM_00002417001    Cul8 complex      GSTUM_00002417001    Cul9 complex      GSTUM_00002417001 DNA repair and recombination proteins [BR:tml03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       GSTUM_00002417001     TCR (transcription coupled repair) factors      Cul4-CSA complex       GSTUM_00002417001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  9185298 NCBI-ProteinID:  XP_002836209 INRA:  GSTUM_00002417001 UniProt:  D5G7A7 LinkDB All DBs AA seq 112 aa AA seqDB search MADVDMKDAKVISKGESSEPTKKPRFEVKKWNAVALWSWDIVVENCAICRNHIMDLCIEC QANQASAVSEECTVAWGICNHAFHFHCISRWLKTRQVCPLDNRDWEFQKYGK NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggccgatgtcgacatgaaggatgctaaggtcatctccaaaggagaatcatccgagcct accaagaagcccagattcgaggtcaagaaatggaatgcagtagcactatggtcttgggat atcgttgtcgaaaactgtgccatctgccgtaaccacattatggatctctgcatcgaatgc caggcaaatcaggctagcgcagtgagtgaagaatgtactgttgcctggggtatctgcaac catgcctttcacttccattgtatctcgcgttggctaaaaacccgccaagtctgccctctc gataaccgagattgggagttccagaagtacggaaaatag

DBGET integrated database retrieval system