Trichoplusia ni (cabbage looper): 113493416 Help Entry 113493416         CDS       T05757                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism tnl  Trichoplusia ni (cabbage looper) Pathway tnl00510   N-Glycan biosynthesis tnl00513   Various types of N-glycan biosynthesis tnl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tnl00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     113493416    00513 Various types of N-glycan biosynthesis     113493416  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113493416 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  113493416 NCBI-ProteinID:  XP_026727190 UniProt:  A0A7E5VFY2 LinkDB All DBs Position 4:18342176..18342530 Genome browser AA seq 74 aa AA seqDB search MIRYTSPINPAVFPHLTVLLLGIGIFFTAWFFVYEVTSTKLSRDLFKELTLSLVAALFSG FGILFLLLWVGIYV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgatccggtacacgtctcctatcaacccggcagttttcccacatctaacagtccttctc cttggcatcggcatattcttcacggcctggttcttcgtctatgaagtcacgagcacaaag ttatcgagggatctattcaaagagttaacgctatcactggtcgcggcattattctcggga ttcggaattctcttcttgctattgtgggttggaatctacgtgtga

DBGET integrated database retrieval system