Talpa occidentalis (Iberian mole): 119230923 Help Entry 119230923         CDS       T07495                                  Symbol ACTG1 Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod03082   ATP-dependent chromatin remodeling tod04015   Rap1 signaling pathway tod04145   Phagosome tod04210   Apoptosis tod04390   Hippo signaling pathway tod04510   Focal adhesion tod04520   Adherens junction tod04530   Tight junction tod04611   Platelet activation tod04613   Neutrophil extracellular trap formation tod04670   Leukocyte transendothelial migration tod04714   Thermogenesis tod04810   Regulation of actin cytoskeleton tod04814   Motor proteins tod04820   Cytoskeleton in muscle cells tod04919   Thyroid hormone signaling pathway tod04921   Oxytocin signaling pathway tod04971   Gastric acid secretion tod05014   Amyotrophic lateral sclerosis tod05100   Bacterial invasion of epithelial cells tod05132   Salmonella infection tod05135   Yersinia infection tod05164   Influenza A tod05205   Proteoglycans in cancer tod05225   Hepatocellular carcinoma tod05410   Hypertrophic cardiomyopathy tod05412   Arrhythmogenic right ventricular cardiomyopathy tod05414   Dilated cardiomyopathy tod05416   Viral myocarditis tod05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     119230923 (ACTG1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     119230923 (ACTG1)    04390 Hippo signaling pathway     119230923 (ACTG1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     119230923 (ACTG1)   09143 Cell growth and death    04210 Apoptosis     119230923 (ACTG1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     119230923 (ACTG1)    04520 Adherens junction     119230923 (ACTG1)    04530 Tight junction     119230923 (ACTG1)   09142 Cell motility    04814 Motor proteins     119230923 (ACTG1)    04820 Cytoskeleton in muscle cells     119230923 (ACTG1)    04810 Regulation of actin cytoskeleton     119230923 (ACTG1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     119230923 (ACTG1)    04613 Neutrophil extracellular trap formation     119230923 (ACTG1)    04670 Leukocyte transendothelial migration     119230923 (ACTG1)   09152 Endocrine system    04921 Oxytocin signaling pathway     119230923 (ACTG1)    04919 Thyroid hormone signaling pathway     119230923 (ACTG1)   09154 Digestive system    04971 Gastric acid secretion     119230923 (ACTG1)   09159 Environmental adaptation    04714 Thermogenesis     119230923 (ACTG1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     119230923 (ACTG1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     119230923 (ACTG1)   09172 Infectious disease: viral    05164 Influenza A     119230923 (ACTG1)   09171 Infectious disease: bacterial    05132 Salmonella infection     119230923 (ACTG1)    05135 Yersinia infection     119230923 (ACTG1)    05100 Bacterial invasion of epithelial cells     119230923 (ACTG1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     119230923 (ACTG1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     119230923 (ACTG1)    05410 Hypertrophic cardiomyopathy     119230923 (ACTG1)    05412 Arrhythmogenic right ventricular cardiomyopathy     119230923 (ACTG1)    05414 Dilated cardiomyopathy     119230923 (ACTG1)    05416 Viral myocarditis     119230923 (ACTG1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tod03021]     119230923 (ACTG1)    03019 Messenger RNA biogenesis [BR:tod03019]     119230923 (ACTG1)    03036 Chromosome and associated proteins [BR:tod03036]     119230923 (ACTG1)    03029 Mitochondrial biogenesis [BR:tod03029]     119230923 (ACTG1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tod04812]     119230923 (ACTG1)    04147 Exosome [BR:tod04147]     119230923 (ACTG1) Transcription machinery [BR:tod03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      119230923 (ACTG1) Messenger RNA biogenesis [BR:tod03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      119230923 (ACTG1) Chromosome and associated proteins [BR:tod03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      119230923 (ACTG1)     NuA4 complex      119230923 (ACTG1)   Chromatin remodeling factors    BAF complex     119230923 (ACTG1)    PBAF complex     119230923 (ACTG1)    GBAF(ncBAF) complex     119230923 (ACTG1)    SWR1 complex     119230923 (ACTG1) Mitochondrial biogenesis [BR:tod03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     119230923 (ACTG1) Cytoskeleton proteins [BR:tod04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      119230923 (ACTG1) Exosome [BR:tod04147]  Exosomal proteins   Proteins found in most exosomes    119230923 (ACTG1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  119230923 NCBI-ProteinID:  XP_037348386 LinkDB All DBs Position Unknown AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaggagatcgccgcgctcgtcatcgacaacggctccggcatgtgcaaggcgggc ttcgccggcgacgacgcgccgcgcgccgtgttcccgtccatcgtggggcgcccgcggcac cagggcgtcatggtgggcatgggccagaaggactcgtacgtgggcgacgaggcgcagagc aagcgcggcatcctgacgctcaagtaccccatcgagcacggcatcgtcaccaactgggac gacatggagaagatctggcaccacaccttctacaacgagctgcgcgtggcgcccgaggag caccccgtgctgctgaccgaggcgccgctgaaccccaaggccaaccgcgagaagatgacc cagatcatgttcgagaccttcaacacgccggccatgtacgtggccatccaggccgtgctg tccctgtacgcctcgggccgcaccacgggcatcgtcatggactcgggcgacggcgtcacg cacacggtgcccatctacgagggctacgcgctgccgcacgccatcctgcgcctggacctg gcgggccgcgacctgaccgactacctcatgaagatcctcacggagcgcggctacagcttc accaccacggccgagcgcgagatcgtgcgcgacatcaaggagaagctgtgctacgtggcg ctcgacttcgagcaggagatggccacggccgcgtcgtcctcgtcgctggagaagagctac gagctgcccgacggccaggtcatcaccatcggcaacgagcgcttccgctgccccgaggcg ctcttccagccgtccttcctgggcatggagtcctgcggcatccacgagaccaccttcaac tccatcatgaagtgtgacgtggacatccgcaaggacctgtacgccaacacggtgctgtcg gggggcaccaccatgtaccccggcatcgccgaccgcatgcagaaggagatcacggcgctg gcgcccagcaccatgaagatcaagatcatcgcgcccccggagcgcaagtactcggtgtgg atcggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtacgacgagtcgggcccgtccatcgtgcaccgcaagtgcttctga

DBGET integrated database retrieval system