Talpa occidentalis (Iberian mole): 119239195 Help Entry 119239195         CDS       T07495                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism tod  Talpa occidentalis (Iberian mole) Pathway tod03083   Polycomb repressive complex tod04010   MAPK signaling pathway tod05200   Pathways in cancer tod05202   Transcriptional misregulation in cancer tod05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:tod00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     119239195 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119239195 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119239195 (MAX)    05202 Transcriptional misregulation in cancer     119239195 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     119239195 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:tod03000]     119239195 (MAX)    03036 Chromosome and associated proteins [BR:tod03036]     119239195 (MAX) Transcription factors [BR:tod03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     119239195 (MAX) Chromosome and associated proteins [BR:tod03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      119239195 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 GAGA_bind DUF7801 DUF4763 XhlA Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  119239195 NCBI-ProteinID:  XP_037359413 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcacgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgatgacctcaagcggcagaatgcgctcctggagcagcaagtccgt gcactggagaaggcgaggtcaagtgctcaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatggtggctcagactcc agctcggagtcagagcctgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system